Source code for ample.util.pdb_edit

#!/usr/bin/env ccp4-python
'''
Useful manipulations on PDB files
'''

# Python imports
import copy
import glob
import logging
import os
import re
import sys
import unittest

import iotbx.file_reader
import iotbx.pdb
#iotbx.pdb.amino_acid_codes.one_letter_given_three_letter

import ample_util  
import pdb_model
import residue_map
import sequence_util

three2one = {
    'ALA' : 'A',    
    'ARG' : 'R',    
    'ASN' : 'N',    
    'ASP' : 'D',    
    'CYS' : 'C',    
    'GLU' : 'E',    
    'GLN' : 'Q',    
    'GLY' : 'G',    
    'HIS' : 'H',    
    'ILE' : 'I',    
    'LEU' : 'L',    
    'LYS' : 'K',    
    'MET' : 'M',    
    'PHE' : 'F',    
    'PRO' : 'P',    
    'SER' : 'S',    
    'THR' : 'T',    
    'TRP' : 'W',    
    'TYR' : 'Y',   
    'VAL' : 'V',
    'UNK' : 'X'
}

# http://stackoverflow.com/questions/3318625/efficient-bidirectional-hash-table-in-python
#aaDict.update( dict((v, k) for (k, v) in aaDict.items()) )
one2three =  dict((v, k) for (k, v) in three2one.items())

_logger = logging.getLogger()

[docs]def backbone(inpath=None, outpath=None): """Only output backbone atoms. """ # pdbcur segfaults with long pathnames inpath=os.path.relpath(inpath) outpath=os.path.relpath(outpath) logfile = outpath+".log" cmd="pdbcur xyzin {0} xyzout {1}".format( inpath, outpath ).split() # Build up stdin stdin='lvatom "N,CA,C,O,CB[N,C,O]"' #stdin='lvatom "N,CA,C,O[N,C,O]"' retcode = ample_util.run_command(cmd=cmd, logfile=logfile, directory=os.getcwd(), dolog=False, stdin=stdin) if retcode == 0: # remove temporary files os.unlink(logfile) else: raise RuntimeError,"Error stripping PDB to backbone atoms. See log:{0}".format(logfile) return
[docs]def calpha_only(inpdb, outpdb): """Strip PDB to c-alphas only""" logfile = outpdb+".log" cmd="pdbcur xyzin {0} xyzout {1}".format( inpdb, outpdb ).split() # Build up stdin stdin='lvatom "CA[C]:*"' retcode = ample_util.run_command(cmd=cmd, logfile=logfile, directory=os.getcwd(), dolog=False, stdin=stdin) if retcode == 0: # remove temporary files os.unlink(logfile) else: raise RuntimeError,"Error stripping PDB to c-alpha atoms" return
# def cat_pdbs( pdb1=None, pdb2=None, pdbout=None ): # """Concatenate 2 pdbs into a single file. The header from the first is kept and # the chains from the second added to the end of the first # """ # # one = open( pdb1, 'r' ) # lines = [] # # needTer=True # for line in one: # lines.append( line ) # if line.startswith("TER"): # needTer=False # break # one.close() # # if needTer: # lines.append( "TER\n" ) # # needTer=True # two = open( pdb2, 'r' ) # for line in two: # if line.startswith("ATOM"): # lines.append( line ) # continue # # if line.startswith("TER"): # lines.append( line ) # needTer=False # break # two.close() # # if needTer: # lines.append( "TER\n" ) # # lines.append("END\n") # # # Now write 'em out # with open( pdbout, 'w') as o: # o.writelines( lines ) # # return
[docs]def check_pdb_directory(directory,single=True,allsame=True,sequence=None): _logger.info("Checking pdbs in directory: {0}".format(directory)) if not os.path.isdir(directory): _logger.critical("Cannot find directory: {0}".format(directory)) return False models=glob.glob(os.path.join(directory,"*.pdb")) if not len(models): _logger.critical("Cannot find any pdb files in directory: {0}".format(directory)) return False if not (single or sequence or allsame): return True return check_pdbs(models,sequence=sequence,single=single,allsame=allsame)
[docs]def check_pdbs(models,single=True,allsame=True,sequence=None): if allsame and not sequence: # Get sequence from first model try: h=iotbx.pdb.pdb_input(models[0]).construct_hierarchy() except Exception,e: s="*** ERROR reading sequence from first pdb: {0}\n{1}".format(models[0],e) _logger.critical(s) return False sequence = _sequence1(h) # only one model/chain errors = [] multi = [] no_protein = [] sequence_err = [] unnamed_chain = [] for pdb in models: try: h = iotbx.pdb.pdb_input(pdb).construct_hierarchy() except Exception,e: errors.append((pdb,e)) continue if not single: continue if not (h.models_size()==1 and h.models()[0].chains_size()==1): multi.append(pdb) continue # single chain from one model so check is protein if not h.models()[0].chains()[0].is_protein(): no_protein.append(pdb) continue if not h.models()[0].chains()[0].id.strip(): # Check we have a named chain unnamed_chain.append(pdb) continue if sequence: s=_sequence1(h) # only one chain/model if not s == sequence: sequence_err.append((pdb,s)) if not (len(errors) or len(multi) or len(sequence_err) or len(no_protein) or len(unnamed_chain)): _logger.info("check_pdb_directory - pdb files all seem valid") return True s="\n" if len(errors): s="*** ERROR ***\n" s+="The following pdb files have errors:\n\n" for pdb,e in errors: s+="{0}: {1}\n".format(pdb,e) if len(multi): s+="\n" s+="The following pdb files have more than one chain:\n\n" for pdb in multi: s+="{0}\n".format(pdb) if len(no_protein): s+="\n" s+="The following pdb files do not appear to contain any protein:\n\n" for pdb in no_protein: s+="{0}\n".format(pdb) if len(unnamed_chain): s+="\n" s+="The following pdb files do not have named chains:\n\n" for pdb in unnamed_chain: s+="{0}\n".format(pdb) if len(sequence_err): s+="\n" s+="The following pdb files have differing sequences from the reference sequence:\n\n{0}\n\n".format(sequence) for pdb,seq in sequence_err: s+="PDB: {0}\n{1}\n".format(pdb,seq) _logger.critical(s) return False
[docs]def extract_chain(inpdb, outpdb, chainID=None, newChainID=None, cAlphaOnly=False, renumber=True ): """Extract chainID from inpdb and renumner. If cAlphaOnly is set, strip down to c-alpha atoms """ logfile = outpdb+".log" cmd="pdbcur xyzin {0} xyzout {1}".format( inpdb, outpdb ).split() # Build up stdin stdin="lvchain {0}\n".format( chainID ) if newChainID: stdin += "renchain {0} {1}\n".format( chainID, newChainID ) if cAlphaOnly: stdin += 'lvatom "CA[C]:*"\n' if renumber: stdin += "sernum\n" retcode = ample_util.run_command(cmd=cmd, logfile=logfile, directory=os.getcwd(), dolog=False, stdin=stdin) if retcode == 0: # remove temporary files os.unlink(logfile) else: raise RuntimeError,"Error extracting chain {0}".format( chainID ) return
[docs]def extract_model(inpdb, outpdb, modelID ): """Extract modelID from inpdb into outpdb""" assert modelID>0 logfile = outpdb+".log" cmd="pdbcur xyzin {0} xyzout {1}".format( inpdb, outpdb ).split() # Build up stdin stdin="lvmodel /{0}\n".format( modelID ) #stdin += "sernum\n" retcode = ample_util.run_command(cmd=cmd, logfile=logfile, directory=os.getcwd(), dolog=False, stdin=stdin) if retcode != 0: raise RuntimeError,"Problem extracting model with cmd: {0}".format # remove temporary files os.unlink(logfile) return
[docs]def extract_header_pdb_code(pdb_input): for line in pdb_input.title_section(): if line.startswith("HEADER ") and len(line) >= 65: return line[62:66] return None
[docs]def extract_header_title(pdb_input): for line in pdb_input.title_section(): if line.startswith('TITLE') : return line[10:-1].strip() return None
# def get_resseq_map(nativePdb, modelPdb ): # """Return a ResSeqMap mapping the index of a residue in the model to the corresponding residue in the native. # Only works if 1 chain in either file and with standard residues # """ # # def _get_indices( pdb ): # """Get fastaSequence as string of 1AA # get list of matching resSeq # """ # # # print "GETTING INDICES ",pdb # # fastaSequence = "" # resSeq = [] # # atomTypes = [] # For checking we have all required atom types # backbone = [ 'N', 'CA', 'C', 'O','CB' ] # # backboneMask = [] # cAlphaMask = [] # # chain=None # readingResSeq=None # readingResName=None # for line in open( pdb ): # # if line.startswith("MODEL"): # raise RuntimeError,"FOUND MULTI_MODEL FILE!" # # if line.startswith("ATOM"): # # atom = pdb_model.PdbAtom( line ) # # if not chain: # chain = atom.chainID # # if atom.chainID != chain: # raise RuntimeError," FOUND ADDITIONAL CHAIN" # break # # if atom.name not in atomTypes: # atomTypes.append( atom.name.strip() ) # # # First atom in first residue # if readingResSeq == None: # readingResSeq = atom.resSeq # readingResName = atom.resName # continue # # if readingResSeq != atom.resSeq: # # Adding a new residue # # # # # # Add the atom we've just finished reading # fastaSequence += three2one[ readingResName ] # resSeq.append( readingResSeq ) # # got=False # if 'CA' not in atomTypes: # cAlphaMask.append( True ) # got=True # else: # cAlphaMask.append( False ) # # # if not got: # If we haven't got CA we don't need to check # for at in backbone: # If we need to mask this residue for backbone atoms # if at not in atomTypes: # got=True # break # #s = "Atom type {0} is not present in atom types for residue {1} - only got atomTypes: {2}".format( at, readingResSeq, atomTypes ) # #print s # # if got: # backboneMask.append( True ) # else: # backboneMask.append( False ) # # # readingResSeq = atom.resSeq # readingResName = atom.resName # atomTypes = [] # # return ( fastaSequence, resSeq, cAlphaMask, backboneMask ) # # native_seq, native_idx = _get_indices( nativePdb ) # model_seq, model_idx = _get_indices( modelPdb ) # # # The window of AA we used to check for a match # PROBE_LEN = 10 # # if len(native_seq) < 20 or len(model_seq) < 20: # raise RuntimeError,"Very short sequences - this will not work!" # # # MAXINSET is the max number of AA into the sequence that we will go searching for a match - i.e. if more # # then MAXINSET AA are non-matching, we won't find the match # #MAXINSET=30 if len( model_seq ) > 30 else len( model_seq ) - ( PROBE_LEN + 2) # if len( model_seq ) > 30: # MAXINSET=30 # else: # MAXINSET = len( model_seq ) - ( PROBE_LEN + 2) # # got=False # for model_i in range( MAXINSET ): # probe = model_seq[ model_i : model_i+PROBE_LEN-1 ] # for native_i in range( MAXINSET ): # if native_seq[ native_i:native_i+PROBE_LEN-1 ] == probe: # got=True # break # # if got: # #print "GOT MODEL MATCH AT i,j ",model_i,native_i # break # # # Now we know where they start we can sort out the indicies # # map goes from the model -> native. For any in model that are not in native we set them to None # resMap = residueSequenceMap() # resMap._modelResSeqMap = model_idx # # for i in range( len( model_seq ) ): # # if i < model_i: # # These are residues that are present in the model but not in the native # resMap._nativeResSeqMap.append( None ) # continue # # pos = i - model_i + native_i # if pos >= len( native_idx ): # resMap._nativeResSeqMap.append( None ) # else: # resMap._nativeResSeqMap.append( native_idx[ pos ] ) # # # if resMap._nativeResSeqMap != resMap._modelResSeqMap: # raise RuntimeError, "Mismatching maps: {0}".format( resMap ) # # return resMap
[docs]def keep_matching(refpdb=None, targetpdb=None, outpdb=None, resSeqMap=None ): """Only keep those atoms in targetpdb that are in refpdb and write the result to outpdb. We also take care of renaming any chains. """ assert refpdb and targetpdb and outpdb and resSeqMap # Paranoid check if False: refinfo = get_info( refpdb ) targetinfo = get_info( targetpdb ) if len(refinfo.models) > 1 or len(targetinfo.models) > 1: raise RuntimeError, "PDBS contain more than 1 model!" if refinfo.models[0].chains != targetinfo.models[0].chains: raise RuntimeError, "Different numbers/names of chains {0}->{1} between {2} and {3}!".format( refinfo.models[0].chains, targetinfo.models[0].chains, refpdb, targetpdb ) # Now we do our keep matching tmp1 = ample_util.tmp_file_name()+".pdb" # pdbcur insists names have a .pdb suffix _keep_matching( refpdb, targetpdb, tmp1, resSeqMap=resSeqMap ) # now renumber with pdbcur logfile = tmp1+".log" cmd="pdbcur xyzin {0} xyzout {1}".format( tmp1, outpdb ).split() stdint="""sernum """ retcode = ample_util.run_command(cmd=cmd, logfile=logfile, directory=os.getcwd(), dolog=False, stdin=stdint) if retcode == 0: # remove temporary files os.unlink(tmp1) os.unlink(logfile) return retcode
def _keep_matching(refpdb=None, targetpdb=None, outpdb=None, resSeqMap=None ): """Create a new pdb file that only contains that atoms in targetpdb that are also in refpdb. It only considers ATOM lines and discards HETATM lines in the target. Args: refpdb: path to pdb that contains the minimal set of atoms we want to keep targetpdb: path to the pdb that will be stripped of non-matching atoms outpdb: output path for the stripped pdb """ assert refpdb and targetpdb and outpdb and resSeqMap def _output_residue(refResidues, targetAtomList, resSeqMap, outfh): """Output a single residue only outputting matching atoms, shuffling the atom order and changing the resSeq num""" # Get the matching list of atoms targetResSeq = targetAtomList[0].resSeq refResSeq = resSeqMap.ref2target( targetResSeq ) # Get the atomlist for the reference for ( rid, alist ) in refResidues: if rid == refResSeq: refAtomList = alist break # Get ordered list of the ref atom names for this residue rnames = [ x.name for x in refAtomList ] #print "got rnames ",rnames #print "got anames ", [ x.name for x in targetAtomList ] if len( refAtomList ) > len( targetAtomList ): s = "Cannot keep matching as refAtomList is > targetAtomList for residue {0}\nRef: {1}\nTrg: {2}".format( targetResSeq, rnames, [ x.name for x in targetAtomList ] ) raise RuntimeError, s # Remove any not matching in the target alist = [] for atom in targetAtomList: if atom.name in rnames: alist.append( atom ) # List now only contains matching atoms targetAtomList = alist #print "tnames ",[ x.name for x in targetAtomList ] # Now just have matching so output in the correct order for refname in rnames: for i,atom in enumerate( targetAtomList ): if atom.name == refname: # Found the matching atom # Change resSeq and write out atom.resSeq = refResSeq outfh.write( atom.toLine()+"\n" ) # now delete both this atom and the line targetAtomList.pop(i) # jump out of inner loop break return # Go through refpdb and find which refResidues are present refResidues = [] targetResSeq = [] # ordered list of tuples - ( resSeq, [ list_of_atoms_for_that_residue ] ) last = None chain = -1 for line in open(refpdb, 'r'): if line.startswith("MODEL"): raise RuntimeError, "Multi-model file!" if line.startswith("TER"): break if line.startswith("ATOM"): a = pdb_model.PdbAtom( line ) # First atom/chain if chain == -1: chain = a.chainID if a.chainID != chain: raise RuntimeError, "ENCOUNTERED ANOTHER CHAIN! {0}".format( line ) if a.resSeq != last: last = a.resSeq # Add the corresponding resSeq in the target targetResSeq.append( resSeqMap.target2ref( a.resSeq ) ) refResidues.append( ( a.resSeq, [ a ] ) ) else: refResidues[ -1 ][ 1 ].append( a ) # Now read in target pdb and output everything bar the atoms in this file that # don't match those in the refpdb t = open(targetpdb,'r') out = open(outpdb,'w') chain=None # The chain we're reading residue=None # the residue we're reading targetAtomList = [] for line in t: if line.startswith("MODEL"): raise RuntimeError, "Multi-model file!" if line.startswith("ANISOU"): raise RuntimeError, "I cannot cope with ANISOU! {0}".format(line) # Stop at TER if line.startswith("TER"): _output_residue( refResidues, targetAtomList, resSeqMap, out ) # we write out our own TER out.write("TER\n") continue if line.startswith("ATOM"): atom = pdb_model.PdbAtom( line ) # First atom/chain if chain == None: chain = atom.chainID if atom.chainID != chain: raise RuntimeError, "ENCOUNTERED ANOTHER CHAIN! {0}".format( line ) if atom.resSeq in targetResSeq: # If this is the first one add the empty tuple and reset residue if atom.resSeq != residue: if residue != None: # Dont' write out owt for first atom _output_residue( refResidues, targetAtomList, resSeqMap, out ) targetAtomList = [] residue = atom.resSeq # If not first keep adding targetAtomList.append( atom ) # We don't write these out as we write them with _output_residue continue else: # discard this line as not a matching atom continue # For time being exclude all HETATM lines elif line.startswith("HETATM"): continue #Endif line.startswith("ATOM") # Output everything else out.write(line) # End reading loop t.close() out.close() return # OLD STUFF FOR MULTIPLE CHAINS AND WITHOUT THE residueSequenceMap # def _keep_matching(refpdb=None, targetpdb=None, outpdb=None ): # """Create a new pdb file that only contains that atoms in targetpdb that are # also in refpdb. It only considers ATOM lines and discards HETATM lines in the target. # # Args: # refpdb: path to pdb that contains the minimal set of atoms we want to keep # targetpdb: path to the pdb that will be stripped of non-matching atoms # outpdb: output path for the stripped pdb # """ # # assert refpdb and targetpdb and outpdb # # def _write_matching_residues( chain, refResidues, target_residues, outfh ): # # #print "got target_residues: {0}".format(target_residues) # # # Loop over each residue in turn # for idx, atoms_and_lines in sorted( target_residues[ chain ].items() ): # # # Get ordered list of the ref atom names for this residue # rnames = [ x.name for x in refResidues[ chain ][ idx ] ] # # #print "rnames ",rnames # # # Remove any not matching # atoms = [] # atom_lines = [] # for i, a in enumerate( atoms_and_lines[0] ): # if a.name in rnames: # atoms.append( atoms_and_lines[0][i] ) # atom_lines.append( atoms_and_lines[1][i] ) # # # # Now just have matching so output in the correct order # for refname in rnames: # for i, atom in enumerate( atoms ): # if atom.name == refname: # # Found the matching atom so write out the corresponding line # outfh.write( atom_lines[i] ) # # now delete both this atom and the line # atoms.pop(i) # atom_lines.pop(i) # # jump out of inner loop # break # # # We delete the chain we've written out so that we don't write it out again at the # # end by mistake # del refResidues[ chainIdx ] # del target_residues[ chainIdx ] # return # # # Go through refpdb and find which refResidues are present # f = open(refpdb, 'r') # # # map of resSeq to list of PdbAtom objects for the reference residues # refResidues = {} # # last = None # chain = -1 # chainIdx=-1 # For the time being we key by the chain index so we can deal with # # proteins that have different chain IDs # for line in f: # if line.startswith("MODEL"): # raise RuntimeError, "Multi-model file!" # # if line.startswith("ATOM"): # a = pdb_model.PdbAtom( line ) # # if a.chainID != chain: # chain = a.chainID # chainIdx+=1 # if chainIdx in refResidues: # raise RuntimeError, "ENCOUNTERED CHAIN AGAIN! {0}".format( line ) # refResidues[ chainIdx ] = {} # # if a.resSeq != last: # #if a.resSeq in refResidues: # # raise RuntimeError,"Multiple chains in pdb - found residue #: {0} again.".format(a.resSeq) # last = a.resSeq # #refResidues[ last ] = [ a ] # refResidues[ chainIdx ][ last ] = [ a ] # else: # #refResidues[ last ].append( a ) # refResidues[ chainIdx ][ last ].append( a ) # # f.close() # # #print "got refResidues: {0}".format(refResidues) # # # Now read in target pdb and output everything bar the atoms in this file that # # don't match those in the refpdb # t = open(targetpdb,'r') # out = open(outpdb,'w') # # reading=-1 # The residue we are reading - set to -1 when we are not reading # chain=-1 # The chain we're reading # chainIdx=-1 # see above # # target_residues = {} # dict mapping residue index to a a tuple of (atoms, lines), where atoms is a list of the atom # # objects and lines is a list of the lines used to create the atom objects # # for line in t: # # if line.startswith("MODEL"): # raise RuntimeError, "Multi-model file!" # # if line.startswith("ANISOU"): # raise RuntimeError, "I cannot cope with ANISOU! {0}".format(line) # # # Stop at TER # if line.startswith("TER"): # # we write out our own TER # _write_matching_residues( chainIdx, refResidues, target_residues, out ) # out.write("TER\n") # continue # # if line.startswith("ATOM"): # # atom = pdb_model.PdbAtom( line ) # # # different/first chain # if atom.chainID != chain: # chain = atom.chainID # chainIdx+=1 # if chainIdx in target_residues: # raise RuntimeError, "ENCOUNTERED CHAIN IN TARGET AGAIN! {0}".format( line ) # target_residues[ chainIdx ] = {} # # # We copy resSeq to make sure we don't use a reference for our index # resSeq = copy.copy( atom.resSeq ) # # # Skip any refResidues that don't match # if resSeq in refResidues[ chainIdx ]: # # # If this is the first one add the empty tuple and reset reading # if reading != resSeq: # # each tuple is a list of atom objects and lines # target_residues[ chainIdx ][ resSeq ] = ( [], [] ) # reading = resSeq # # target_residues[ chainIdx ][ resSeq ][0].append( atom ) # target_residues[ chainIdx ][ resSeq ][1].append( line ) # # # we don't write out any atom lines as they are either not matching or # # we write out matching at the end # continue # # # For time being exclude all HETATM lines # elif line.startswith("HETATM"): # continue # #Endif line.startswith("ATOM") # # # Output everything else # out.write(line) # # # End reading loop # # # For some PDBS there is no ending TER so we need to check if we've written this out yet or not # if target_residues.has_key( chainIdx ): # _write_matching_residues( chainIdx, refResidues, target_residues, out ) # out.write("TER\n\n") # # t.close() # out.close() # # return
[docs]def get_info(inpath): """Read a PDB and extract as much information as possible into a PdbInfo object """ info = pdb_model.PdbInfo() info.pdb = inpath currentModel = None currentChain = -1 modelAtoms = [] # list of models, each of which is a list of chains with the list of atoms # Go through refpdb and find which ref_residues are present f = open(inpath, 'r') line = f.readline() while line: # First line of title if line.startswith('HEADER'): info.pdbCode = line[62:66].strip() # First line of title if line.startswith('TITLE') and not info.title: info.title = line[10:-1].strip() if line.startswith("REMARK"): try: numRemark = int(line[7:10]) except ValueError: line=f.readline() continue # Resolution if numRemark == 2: line = f.readline() if line.find("RESOLUTION") != -1: try: info.resolution = float( line[25:30] ) except ValueError: # RESOLUTION. NOT APPLICABLE. info.resolution=-1 # Get solvent content if numRemark == 280: maxread = 5 # Clunky - read up to maxread lines to see if we can get the information we're after # We assume the floats are at the end of the lines for _ in range( maxread ): line = f.readline() if line.find("SOLVENT CONTENT") != -1: try: info.solventContent = float( line.split()[-1] ) except ValueError: # Leave as None pass if line.find("MATTHEWS COEFFICIENT") != -1: try: info.matthewsCoefficient = float( line.split()[-1] ) except ValueError: # Leave as None pass #End REMARK if line.startswith("CRYST1"): try: info.crystalInfo = pdb_model.CrystalInfo( line ) except ValueError,e: # Bug in pdbset nukes the CRYST1 line so we need to catch this print "ERROR READING CRYST1 LINE in file {0}\":{1}\"\n{2}".format(inpath,line.rstrip(),e) info.crystalInfo=None if line.startswith("MODEL"): if currentModel: # Need to make sure that we have an id if only 1 chain and none given if len( currentModel.chains ) <= 1: if currentModel.chains[0] == None: currentModel.chains[0] = 'A' info.models.append( currentModel ) # New/first model currentModel = pdb_model.PdbModel() # Get serial currentModel.serial = int(line.split()[1]) currentChain = None modelAtoms.append( [] ) # Count chains (could also check against the COMPND line if present?) if line.startswith('ATOM'): # Create atom object atom = pdb_model.PdbAtom(line) # Check for the first model if not currentModel: # This must be the first model and there should only be one currentModel = pdb_model.PdbModel() modelAtoms.append( [] ) if atom.chainID != currentChain: currentChain = atom.chainID currentModel.chains.append( currentChain ) modelAtoms[ -1 ].append( [] ) modelAtoms[ -1 ][-1].append( atom ) # Can ignore TER and ENDMDL for time being as we'll pick up changing chains anyway, # and new models get picked up by the models line line = f.readline() # End while loop # End of reading loop so add the last model to the list info.models.append( currentModel ) f.close() bbatoms = [ 'N','CA','C','O','CB' ] # Now process the atoms for modelIdx, model in enumerate( info.models ): chainList = modelAtoms[ modelIdx ] for chainIdx, atomList in enumerate( chainList ): # Paranoid check assert model.chains[ chainIdx ] == atomList[0].chainID # Add list of atoms to model model.atoms.append( atomList ) # Initialise new chain currentResSeq = atomList[0].resSeq currentResName = atomList[0].resName model.resSeqs.append( [] ) model.sequences.append( "" ) model.caMask.append( [] ) model.bbMask.append( [] ) atomTypes = [] for i, atom in enumerate( atomList ): aname = atom.name.strip() if atom.resSeq != currentResSeq and i == len(atomList) -1 : # Edge case - last residue containing one atom atomTypes = [ aname ] else: if aname not in atomTypes: atomTypes.append( aname ) if atom.resSeq != currentResSeq or i == len(atomList) -1 : # End of reading the atoms for a residue model.resSeqs[ chainIdx ].append( currentResSeq ) model.sequences[ chainIdx ] += three2one[ currentResName ] if 'CA' not in atomTypes: model.caMask[ chainIdx ].append( True ) else: model.caMask[ chainIdx ].append( False ) missing=False for bb in bbatoms: if bb not in atomTypes: missing=True break if missing: model.bbMask[ chainIdx ].append( True ) else: model.bbMask[ chainIdx ].append( False ) currentResSeq = atom.resSeq currentResName = atom.resName atomTypes = [] return info
[docs]def match_resseq(targetPdb=None, outPdb=None, resMap=None, sourcePdb=None ): """ """ assert sourcePdb or resMap assert not ( sourcePdb and resMap ) if not resMap: resMap = residue_map.residueSequenceMap( targetPdb, sourcePdb ) target = open(targetPdb,'r') out = open(outPdb,'w') chain=None # The chain we're reading residue=None # the residue we're reading for line in target: if line.startswith("MODEL"): raise RuntimeError, "Multi-model file!" if line.startswith("ANISOU"): raise RuntimeError, "I cannot cope with ANISOU! {0}".format(line) # Stop at TER if line.startswith("TER"): # we write out our own TER #out.write("TER\n") #break pass if line.startswith("ATOM"): atom = pdb_model.PdbAtom( line ) # First atom/chain if chain == None: chain = atom.chainID if atom.chainID != chain: pass #raise RuntimeError, "ENCOUNTERED ANOTHER CHAIN! {0}".format( line ) # Get the matching resSeq for the model modelResSeq = resMap.ref2target( atom.resSeq ) if modelResSeq == atom.resSeq: out.write( line ) else: atom.resSeq = modelResSeq out.write( atom.toLine()+"\n" ) continue #Endif line.startswith("ATOM") # Output everything else out.write(line) # End reading loop target.close() out.close() return
# def match_resseq(self, targetPdb, sourcePdb, keepAtoms="all", workdir=None, resSeqMap=None ): # """Given a native pdb file and a model pdb file, create a copy of the native that can be directly compared with the model # # args: # targetPdb: # sourcePdb: # keepAtoms: all, backbone or calpha - the atoms which are to be kept for the comparision # # """ # # if not workdir: # workdir = os.curdir() # # if not resSeqMap: # # Calculate the RefSeqMap - need to do this before we reduce to c-alphas # resSeqMap = residue_map.residueSequenceMap( targetPdb, sourcePdb ) # # # Find out if there are atoms in the model that we need to remove # modelIncomparable = resSeqMap.modelIncomparable() # if len( modelIncomparable ): # # n = os.path.splitext( os.path.basename( targetPdb ) )[0] # nativePdbCut = os.path.join( workdir, n+"_cut.pdb" ) # # logfile = "{0}.log".format( nativePdbCut ) # cmd="pdbcur xyzin {0} xyzout {1}".format( targetPdb, nativePdbCut ).split() # # # Build up stdin - I'm too thick to work out the selection syntax for a discrete list # stdin = "" # for e in modelIncomparable: # stdin += "delresidue {0}\n".format( e ) # # retcode = ample_util.run_command(cmd=cmd, logfile=logfile, directory=workdir, dolog=False, stdin=stdin) # # if retcode == 0: # # remove temporary files # os.unlink(logfile) # else: # raise RuntimeError,"Error deleting residues {0}".format( modelIncomparable ) # # targetPdb = nativePdbCut # # # if keepAtoms == "calpha": # # If only alpha atoms are required, we create a copy of the model with only alpha atoms # n = os.path.splitext( os.path.basename( targetPdb ) )[0] # tmp = os.path.join( workdir, n+"_cAlphaOnly.pdb" ) # calpha_only( targetPdb, tmp ) # targetPdb = tmp # elif keepAtoms == "backbone": # # Strip down to backbone atoms # n = os.path.splitext( os.path.basename( targetPdb ) )[0] # tmp = os.path.join( workdir, n+"_backbone.pdb" ) # backbone( targetPdb, tmp ) # targetPdb = tmp # elif keepAtoms == "all": # pass # else: # raise RuntimeError,"Unrecognised keepAtoms: {0}".format( keepAtoms ) # # # Now create a PDB with the matching atoms from native that are in refined # n = os.path.splitext( os.path.basename( targetPdb ) )[0] # nativePdbMatch = os.path.join( workdir, n+"_matched.pdb" ) # keep_matching( refpdb=refinedPdb, targetpdb=targetPdb, outpdb=nativePdbMatch, resSeqMap=resSeqMap ) # # return
[docs]def merge(pdb1=None, pdb2=None, pdbout=None ): """Merge two pdb files into one""" logfile = pdbout+".log" cmd=[ 'pdb_merge', 'xyzin1', pdb1, 'xyzin2', pdb2, 'xyzout', pdbout ] # Build up stdin stdin='nomerge' retcode = ample_util.run_command(cmd=cmd, logfile=logfile, directory=os.getcwd(), dolog=False, stdin=stdin) if retcode == 0: # remove temporary files os.unlink(logfile) else: raise RuntimeError,"Error merging pdbs: {0} {1}".format( pdb1, pdb2 ) return
[docs]def molecular_weight(pdbin): logfile = "rwcontents.log" _run_rwcontents(pdbin, logfile) _, _, mw = _parse_rwcontents(logfile) os.unlink(logfile) return mw
[docs]def num_atoms_and_residues(pdbin,first=False): """"Return number of atoms and residues in a pdb file. If all is True, return all atoms and residues, else just for the first chain in the first model' """ #pdb_obj = iotbx.pdb.hierarchy.input(file_name=pdbin) #model = pdb_obj.hierarchy.models()[0] #return sum( [ len( chain.residues() ) for chain in model.chains() ] ) if not first: logfile = "rwcontents.log" _run_rwcontents(pdbin, logfile) natoms, nresidues, _ = _parse_rwcontents(logfile) os.unlink(logfile) else: pdb_obj = iotbx.pdb.hierarchy.input(file_name=pdbin) model=pdb_obj.hierarchy.models()[0] nresidues=len(model.chains()[0].residues()) natoms=len(model.chains()[0].atoms()) assert natoms > 0 and nresidues > 0 return (natoms, nresidues)
def _parse_rwcontents(logfile): natoms = 0 nresidues = 0 molecular_weight = 0 with open( logfile ) as f: for line in f: if line.startswith(" Number of amino-acids residues"): nresidues = int(line.strip().split()[5]) #Total number of protein atoms (including hydrogens) if line.startswith(" Total number of atoms (including hydrogens)"): natoms = int(float(line.strip().split()[6])) if line.startswith(" Molecular Weight of protein:"): molecular_weight = float(line.strip().split()[4]) return natoms, nresidues, molecular_weight def _run_rwcontents(pdbin, logfile): logfile = os.path.abspath(logfile) cmd=[ 'rwcontents', 'xyzin', pdbin ] stdin='' # blank to trigger EOF retcode = ample_util.run_command(cmd=cmd, directory=os.getcwd(), logfile=logfile, stdin=stdin) if retcode != 0: raise RuntimeError,"Error running cmd {0}\nSee logfile: {1}".format(cmd,logfile) return def _parse_modres(modres_text): """ COLUMNS DATA TYPE FIELD DEFINITION -------------------------------------------------------------------------------- 1 - 6 Record name "MODRES" 8 - 11 IDcode idCode ID code of this entry. 13 - 15 Residue name resName Residue name used in this entry. 17 Character chainID Chain identifier. 19 - 22 Integer seqNum Sequence number. 23 AChar iCode Insertion code. 25 - 27 Residue name stdRes Standard residue name. 30 - 70 String comment Description of the residue modification. """ modres = [] for line in modres_text: assert line[0:6] == "MODRES","Line did not begin with an MODRES record!: {0}".format(line) idCode = line[7:11] resName = line[12:15].strip() # Use for all so None means an empty field if line[16].strip(): chainID = line[16] seqNum = int(line[18:22]) iCode = "" if line[22].strip(): iCode = line[22] stdRes = line[24:27].strip() comment = "" if line[29:70].strip(): comment = line[29:70].strip() modres.append([idCode, resName, chainID, seqNum, iCode, stdRes,comment]) return modres
[docs]def prepare_nmr_model(nmr_model_in,models_dir): """Split an nmr pdb into its constituent parts and standardise the lengths""" if not os.path.isdir(models_dir): os.mkdir(models_dir) split_pdbs = split_pdb(nmr_model_in, models_dir) # We can only work with equally sized PDBS so we pick the most numerous if there are different sizes lengths = {} lmax = 0 for pdb in split_pdbs: h = iotbx.pdb.pdb_input(pdb).construct_hierarchy() l = h.models()[0].chains()[0].residue_groups_size() if l not in lengths: lengths[l] = [pdb] else: lengths[l].append(pdb) lmax = max(lmax,l) if len(lengths) > 1: # The pdbs were of different lengths to_keep = lengths[lmax] _logger.info('All NMR models were not of the same length, only {0} will be kept.'.format(len(to_keep))) # Delete any that are not of most numerous length for p in [p for p in split_pdbs if p not in to_keep]: os.unlink(p) split_pdbs = to_keep return split_pdbs
[docs]def reliable_sidechains(inpath=None, outpath=None ): """Only output non-backbone atoms for residues in the res_names list. """ # Remove sidechains that are in res_names where the atom name is not in atom_names res_names = [ 'MET', 'ASP', 'PRO', 'GLN', 'LYS', 'ARG', 'GLU', 'SER'] atom_names = [ 'N', 'CA', 'C', 'O', 'CB' ] # print 'Found ',each_file pdb_in = open( inpath, "r" ) pdb_out = open( outpath, "w" ) for pdbline in pdb_in: pdb_pattern = re.compile('^ATOM\s*(\d*)\s*(\w*)\s*(\w*)\s*(\w)\s*(\d*)\s') pdb_result = pdb_pattern.match(pdbline) # Check ATOM line and for residues in res_name, skip any that are not in atom names if pdb_result: pdb_result2 = re.split(pdb_pattern, pdbline) if pdb_result2[3] in res_names and not pdb_result2[2] in atom_names: continue # Write out everything else pdb_out.write(pdbline) #End for pdb_out.close() pdb_in.close() return
[docs]def reliable_sidechains_cctbx(pdbin=None, pdbout=None ): """Only output non-backbone atoms for residues in the res_names list. """ # Remove sidechains that are in res_names where the atom name is not in atom_names res_names = [ 'MET', 'ASP', 'PRO', 'GLN', 'LYS', 'ARG', 'GLU', 'SER'] atom_names = [ 'N', 'CA', 'C', 'O', 'CB' ] pdb_input=iotbx.pdb.pdb_input(pdbin) hierachy=pdb_input.construct_hierarchy() # Remove HETATMS for model in hierachy.models(): for chain in model.chains(): for residue_group in chain.residue_groups(): assert not residue_group.have_conformers(),"Fix for conformers" if residue_group.unique_resnames()[0] not in res_names: # removing whilst looping through?!? - maybe... chain.remove_residue_group(residue_group) continue for atom_group in residue_group.atom_groups(): # Can't use below as it uses indexes which change as we remove atoms # ag.atoms().extract_hetero()] todel=[a for a in atom_group.atoms() if a.name.strip() in atom_names ] for a in todel: atom_group.remove_atom(a) # Need to get crystal info and include hierachy.write_pdb_file(pdbout,anisou=False) return
[docs]def rename_chains(inpdb=None, outpdb=None, fromChain=None, toChain=None ): """Rename Chains """ assert len(fromChain) == len(toChain) logfile = outpdb+".log" cmd="pdbcur xyzin {0} xyzout {1}".format( inpdb, outpdb ).split() # Build up stdin stdin = "" for i in range( len( fromChain ) ): stdin += "renchain {0} {1}\n".format( fromChain[ i ], toChain[ i ] ) retcode = ample_util.run_command(cmd=cmd, logfile=logfile, directory=os.getcwd(), dolog=False, stdin=stdin) if retcode == 0: # remove temporary files os.unlink(logfile) else: raise RuntimeError,"Error renaming chains {0}".format( fromChain ) return
[docs]def resseq(pdbin): return _resseq(iotbx.pdb.pdb_input(pdbin).construct_hierarchy())
def _resseq(hierarchy): """Extract the sequence of residues from a pdb file.""" chain2data = _sequence_data(hierarchy) return dict((k,chain2data[k][1]) for k in chain2data.keys())
[docs]def renumber_residues(pdbin, pdbout, start=1): """ Renumber the residues in the chain """ pdb_input = iotbx.pdb.pdb_input(file_name=pdbin) hierarchy = pdb_input.construct_hierarchy() _renumber(hierarchy, start) with open(pdbout,'w') as f: f.write("REMARK Original file:\n") f.write("REMARK {0}\n".format(pdbin)) f.write(hierarchy.as_pdb_string(anisou=False)) return
def _renumber(hierarchy, start): for model in hierarchy.models(): for chain in model.chains(): for idx, residue_group in enumerate(chain.residue_groups()): residue_group.resseq = idx + start return
[docs]def renumber_residues_gaps(pdbin, pdbout, gaps, start=1): """ Renumber the residues in the chain based on specified gaps Parameters ---------- pdbin : str pdbout : str gaps : list List containing True/False for gaps """ pdb_input = iotbx.pdb.pdb_input(file_name=pdbin) hierarchy = pdb_input.construct_hierarchy() for model in hierarchy.models(): for chain in model.chains(): resseq = 0 for idx, is_gap in enumerate(gaps): if is_gap: continue residue_group = chain.residue_groups()[resseq] residue_group.resseq = idx + start resseq += 1 with open(pdbout, 'w') as f: f.write("REMARK Original file:\n") f.write("REMARK {0}\n".format(pdbin)) f.write(hierarchy.as_pdb_string(anisou=False)) return
[docs]def Xselect_residues(inpath=None, outpath=None, residues=None): """Create a new pdb by selecting only the numbered residues from the list. This only keeps ATOM lines - everything else gets discarded. Args: infile: path to input pdb outfile: path to output pdb residues: list of integers of the residues to keep Return: Number of residues written """ assert inpath, outpath assert type(residues) == list # Loop through PDB files and create new ones that only contain the residues specified in the list count=0 with open(inpath, "r") as pdb_in, open(outpath , "w") as pdb_out: for line in pdb_in: if line.startswith("ATOM"): atom = pdb_model.PdbAtom( line ) if int( atom.resSeq ) in residues: #convert to ints to compare count += 1 pdb_out.write(line) return count
[docs]def select_residues(pdbin, pdbout, delete=None, tokeep=None, delete_idx=None, tokeep_idx=None): pdbf = iotbx.file_reader.any_file(pdbin, force_type="pdb") pdbf.check_file_type("pdb") hierarchy = pdbf.file_object.construct_hierarchy() crystal_symmetry=pdbf.file_object.crystal_symmetry() if len(hierarchy.models()) > 1 or len(hierarchy.models()[0].chains()) > 1: print "pdb {0} has > 1 model or chain - only first model/chain will be kept".format(pdbin) if len(hierarchy.models()) > 1: for i, m in enumerate(hierarchy.models()): if i != 0: hierarchy.remove_model(m) model = hierarchy.models()[0] if len(model.chains()) > 1: for i, c in enumerate(model.chains()): if i != 0: model.remove_chain(c) chain = model.chains()[0] idx=-1 for residue_group in chain.residue_groups(): # We ignore hetatms when indexing as we are concerned with residue indexes if delete_idx or tokeep_idx: if any([atom.hetero for atom in residue_group.atoms()]): continue idx += 1 remove=False if delete: if residue_group.resseq_as_int() in delete: remove = True elif delete_idx: if idx in delete: remove = True elif tokeep: if residue_group.resseq_as_int() not in tokeep: remove = True elif tokeep_idx: if idx not in tokeep_idx: remove = True if remove: chain.remove_residue_group(residue_group) #hierarchy.write_pdb_file(pdbout,anisou=False) with open(pdbout,'w') as f: f.write("REMARK Original file:\n") f.write("REMARK {0}\n".format(pdbin)) if (crystal_symmetry is not None) : f.write(iotbx.pdb.format_cryst1_and_scale_records(crystal_symmetry=crystal_symmetry, write_scale_records=True)+"\n") f.write(hierarchy.as_pdb_string(anisou=False)) return
[docs]def sequence(pdbin): return _sequence(iotbx.pdb.pdb_input(pdbin).construct_hierarchy())
def _sequence(hierarchy): """Extract the sequence of residues from a pdb file.""" chain2data = _sequence_data(hierarchy) return dict((k,chain2data[k][0]) for k in chain2data.keys()) def _sequence1(hierarchy): """Return sequence of the first chain""" d = _sequence(hierarchy) return d[sorted(d.keys())[0]]
[docs]def sequence_data(pdbin): return _sequence_data(iotbx.pdb.pdb_input(pdbin).construct_hierarchy())
def _sequence_data(hierarchy): """Extract the sequence of residues and resseqs from a pdb file.""" chain2data={} for chain in set(hierarchy.models()[0].chains()): # only the first model if not chain.is_protein(): continue got=False seq="" resseq=[] for residue in chain.conformers()[0].residues(): # Just look at the first conformer # See if any of the atoms are non-hetero - if so we add this residue if any([not atom.hetero for atom in residue.atoms()]): got=True seq += three2one[residue.resname] #resseq.append(int(residue.resseq.strip())) resseq.append(residue.resseq_as_int()) if got: chain2data[chain.id] = (seq,resseq) return chain2data
[docs]def Xsplit(pdbin): """Split a pdb into separate models""" name=os.path.splitext(os.path.basename(pdbin))[0] pdb_input=iotbx.pdb.pdb_input(pdbin) hierachy=pdb_input.construct_hierarchy() # Test code for getting info # print "GOT ",[ x for x in pdb_input.title_section()] # print "GOT2 ",pdb_input.extract_header_year() # print "GOT3 ",pdb_input.get_solvent_content() # print "GOT3 ",pdb_input.get_matthews_coeff() # from iotbx.pdb.mining import extract_best_resolution # print "RES ",extract_best_resolution(pdb_input.remark_section()) # print "CODE ",extract_header_pdb_code(pdb_input) # print "TITLE ",extract_header_title(pdb_input) crystal_symmetry=pdb_input.crystal_symmetry() for i,model in enumerate(hierachy.models()): m=model.detached_copy() h=iotbx.pdb.hierarchy.root() h.append_model(m) pdbout="{0}_{1}.pdb".format(name,i) h.write_pdb_file(pdbout,crystal_symmetry=crystal_symmetry,anisou=False) return
[docs]def split_pdb(pdbin, directory=None): """Split a pdb file into its separate models""" if directory is None: directory = os.path.dirname(pdbin) # Largely stolen from pdb_split_models.py in phenix #http://cci.lbl.gov/cctbx_sources/iotbx/command_line/pdb_split_models.py pdbf = iotbx.file_reader.any_file(pdbin, force_type="pdb") pdbf.check_file_type("pdb") hierarchy = pdbf.file_object.construct_hierarchy() # Nothing to do n_models = hierarchy.models_size() if n_models == 1: raise RuntimeError,"split_pdb {0} only contained 1 model!".format( pdbin ) crystal_symmetry=pdbf.file_object.crystal_symmetry() output_files = [] for k, model in enumerate(hierarchy.models()) : k += 1 new_hierarchy = iotbx.pdb.hierarchy.root() new_hierarchy.append_model(model.detached_copy()) if (model.id == "") : model_id = str(k) else: model_id = model.id.strip() output_file = ample_util.filename_append(pdbin, model_id, directory) with open(output_file, "w") as f: if (crystal_symmetry is not None) : print >> f, iotbx.pdb.format_cryst1_and_scale_records( crystal_symmetry=crystal_symmetry, write_scale_records=True) print >> f, "REMARK Model %d of %d" % (k, n_models) if (pdbin is not None) : print >> f, "REMARK Original file:" print >> f, "REMARK %s" % pdbin f.write(new_hierarchy.as_pdb_string()) output_files.append(output_file) return output_files
[docs]def split_into_chains(pdbin, chain=None, directory=None): """Split a pdb file into its separate chains""" if directory is None: directory = os.path.dirname(pdbin) # Largely stolen from pdb_split_models.py in phenix #http://cci.lbl.gov/cctbx_sources/iotbx/command_line/pdb_split_models.py pdbf = iotbx.file_reader.any_file(pdbin, force_type="pdb") pdbf.check_file_type("pdb") hierarchy = pdbf.file_object.construct_hierarchy() # Nothing to do n_models = hierarchy.models_size() if n_models != 1: raise RuntimeError,"split_into_chains only works with single-mdoel pdbs!" crystal_symmetry = pdbf.file_object.crystal_symmetry() output_files = [] n_chains = len(hierarchy.models()[0].chains()) for i, hchain in enumerate(hierarchy.models()[0].chains()): if not hchain.is_protein(): continue if chain and not hchain.id == chain: continue new_hierarchy = iotbx.pdb.hierarchy.root() new_model = iotbx.pdb.hierarchy.model() new_hierarchy.append_model((new_model)) new_model.append_chain(hchain.detached_copy()) output_file = ample_util.filename_append(pdbin, hchain.id, directory) with open(output_file, "w") as f: if (crystal_symmetry is not None) : print >> f, iotbx.pdb.format_cryst1_and_scale_records( crystal_symmetry=crystal_symmetry, write_scale_records=True) print >> f, "REMARK Chain %d of %d" % (i, n_chains) if (pdbin is not None) : print >> f, "REMARK Original file:" print >> f, "REMARK %s" % pdbin f.write(new_hierarchy.as_pdb_string()) output_files.append(output_file) if not len(output_files): raise RuntimeError,"split_into_chains could not find any chains to split" return output_files
[docs]def standardise(pdbin, pdbout, chain=None, del_hetatm=False): """Rename any non-standard AA, remove solvent and only keep most probably conformation. """ tmp1 = ample_util.tmp_file_name() + ".pdb" # pdbcur insists names have a .pdb suffix # Now clean up with pdbcur logfile = tmp1+".log" cmd="pdbcur xyzin {0} xyzout {1}".format(pdbin, tmp1).split() stdin="""delsolvent noanisou mostprob """ # We are extracting one of the chains if chain: stdin += "lvchain {0}\n".format( chain ) retcode = ample_util.run_command(cmd=cmd, logfile=logfile, directory=os.getcwd(), dolog=False, stdin=stdin) if retcode == 0: os.unlink(logfile) # remove temporary files else: raise RuntimeError,"Error standardising pdb!" # Standardise AA names and then remove any remaining HETATMs std_residues_cctbx(tmp1, pdbout, del_hetatm=del_hetatm) os.unlink(tmp1) return retcode
[docs]def Xstd_residues(pdbin, pdbout ): """Switch any non-standard AA's to their standard names. We also remove any ANISOU lines. """ modres = [] # List of modres objects modres_names = {} # list of names of the modified residues keyed by chainID gotModel=False # to make sure we only take the first model reading=False # If reading structure pdbinf = open(pdbin,'r') pdboutf = open(pdbout,'w') line = True # Just for the first line while line: # Read in the line line = pdbinf.readline() # Skip any ANISOU lines if line.startswith("ANISOU"): continue # Extract all MODRES DATA if line.startswith("MODRES"): modres.append( pdb_model.PdbModres( line ) ) # Only extract the first model if line.startswith("MODEL"): if gotModel: raise RuntimeError,"Found additional model! {0}".format( line ) else: gotModel=True # First time we hit coordinates we set up our data structures if not reading and ( line.startswith("HETATM") or line.startswith("ATOM") ): # There is a clever way to do this with list comprehensions but this is not it... for m in modres: chainID = copy.copy( m.chainID ) if not modres_names.has_key( chainID ): modres_names[ chainID ] = [] if m.resName not in modres_names[ chainID ]: modres_names[ chainID ].append( m.resName ) # Now we're reading reading=True # Switch any residue names if len( modres): if line.startswith("HETATM"): hetatm = pdb_model.PdbHetatm( line ) # See if this HETATM is in the chain we are reading and one of the residues to change if hetatm.resName in modres_names[ hetatm.chainID ]: for m in modres: if hetatm.resName == m.resName and hetatm.chainID == m.chainID: # Change this HETATM to an ATOM atom = pdb_model.PdbAtom().fromHetatm( hetatm ) # Switch residue name atom.resName = m.stdRes # Convert to a line line = atom.toLine()+"\n" break # Any HETATM have been dealt with so just process as usual if line.startswith("ATOM"): atom = pdb_model.PdbAtom( line ) if atom.resName not in three2one: raise RuntimeError, "Unrecognised residue! {0}".format(line) # Output everything else pdboutf.write( line ) # END reading loop return
[docs]def std_residues_cctbx(pdbin, pdbout, del_hetatm=False): """Map all residues in MODRES section to their standard counterparts optionally delete all other HETATMS""" pdb_input = iotbx.pdb.pdb_input(pdbin) crystal_symmetry = pdb_input.crystal_symmetry() # Get MODRES Section & build up dict mapping the changes modres_text = [ l.strip() for l in pdb_input.primary_structure_section() \ if l.startswith("MODRES")] modres={} for id,resname,chain,resseq,icode,stdres,comment in _parse_modres(modres_text): if not chain in modres: modres[chain] = {} modres[chain][int(resseq)] = (resname,stdres) hierachy = pdb_input.construct_hierarchy() for model in hierachy.models(): for chain in model.chains(): for residue_group in chain.residue_groups(): resseq = residue_group.resseq_as_int() for atom_group in residue_group.atom_groups(): resname = atom_group.resname if chain.id in modres and resseq in modres[chain.id] and modres[chain.id][resseq][0] == resname: # Change modified name to std name #assert modres[chain.id][resseq][0]==resname,\ #"Unmatched names: {0} : {1}".format(modres[chain.id][resseq][0],resname) atom_group.resname = modres[chain.id][resseq][1] # If any of the atoms are hetatms, set them to be atoms for atom in atom_group.atoms(): if atom.hetero: atom.hetero=False if del_hetatm: _strip(hierachy, hetatm=True) with open(pdbout,'w') as f: f.write("REMARK Original file:\n") f.write("REMARK {0}\n".format(pdbin)) if (crystal_symmetry is not None) : f.write(iotbx.pdb.format_cryst1_and_scale_records(crystal_symmetry=crystal_symmetry, write_scale_records=True)+"\n") f.write(hierachy.as_pdb_string(anisou=False)) return
[docs]def strip(pdbin, pdbout, hetatm=False, hydrogen=False, atom_types=[]): assert hetatm or hydrogen or atom_types,"Need to set what to strip!" pdb_input = iotbx.pdb.pdb_input(pdbin) crystal_symmetry = pdb_input.crystal_symmetry() hierachy = pdb_input.construct_hierarchy() _strip(hierachy, hetatm=hetatm, hydrogen=hydrogen, atom_types=atom_types) with open(pdbout,'w') as f: f.write("REMARK Original file:\n") f.write("REMARK {0}\n".format(pdbin)) if (crystal_symmetry is not None) : f.write(iotbx.pdb.format_cryst1_and_scale_records(crystal_symmetry=crystal_symmetry, write_scale_records=True)+"\n") f.write(hierachy.as_pdb_string(anisou=False)) return
def _strip(hierachy, hetatm=False, hydrogen=False, atom_types=[]): """Remove all hetatoms from pdbfile""" def remove_atom(atom, hetatm=False, hydrogen=False, atom_types=[]): return (hetatm and atom.hetero) or (hydrogen and atom.element_is_hydrogen()) or atom.name.strip() in atom_types for model in hierachy.models(): for chain in model.chains(): for residue_group in chain.residue_groups(): for atom_group in residue_group.atom_groups(): to_del = [ a for a in atom_group.atoms() if remove_atom(a, hetatm=hetatm, hydrogen=hydrogen, atom_types=atom_types)] for atom in to_del: atom_group.remove_atom(atom) return
[docs]def to_single_chain(inpath, outpath): """Condense a single-model multi-chain pdb to a single-chain pdb""" o = open( outpath, 'w' ) firstChainID = None currentResSeq = None # current residue we are reading - assume it always starts from 1 globalResSeq = None globalSerial = -1 for line in open(inpath): # Remove any HETATOM lines and following ANISOU lines if line.startswith("HETATM") or line.startswith("MODEL") or line.startswith("ANISOU"): raise RuntimeError,"Cant cope with the line: {0}".format( line ) # Skip any TER lines if line.startswith("TER"): continue if line.startswith("ATOM"): changed=False atom = pdb_model.PdbAtom( line ) # First atom/residue if globalSerial == -1: globalSerial = atom.serial firstChainID = atom.chainID globalResSeq = atom.resSeq currentResSeq = atom.resSeq else: # Change residue numbering and chainID if atom.chainID != firstChainID: atom.chainID = firstChainID changed=True # Catch each change in residue if atom.resSeq != currentResSeq: # Change of residue currentResSeq = atom.resSeq globalResSeq += 1 # Only change if don't match global if atom.resSeq != globalResSeq: atom.resSeq = globalResSeq changed=True # Catch each change in numbering if atom.serial != globalSerial + 1: atom.serial = globalSerial + 1 changed=True if changed: line = atom.toLine()+"\n" # Increment counter for all atoms globalSerial += 1 o.write( line ) o.close() return
[docs]def translate(inpdb=None, outpdb=None, ftranslate=None): """translate pdb args: ftranslate -- vector of fractional coordinates to shift by """ logfile = outpdb+".log" cmd="pdbcur xyzin {0} xyzout {1}".format( inpdb, outpdb ).split() # Build up stdin stdin='translate * frac {0:F} {1:F} {2:F}'.format( ftranslate[0], ftranslate[1], ftranslate[2] ) retcode = ample_util.run_command(cmd=cmd, logfile=logfile, directory=os.getcwd(), dolog=False, stdin=stdin) if retcode == 0: # remove temporary files os.unlink(logfile) else: raise RuntimeError,"Error translating PDB" return
[docs]def xyz_coordinates(pdbin): ''' Extract xyz for all atoms ''' pdb_input = iotbx.pdb.pdb_input(file_name=pdbin) hierarchy = pdb_input.construct_hierarchy() return _xyz_coordinates(hierarchy)
def _xyz_coordinates(hierarchy): res_lst,tmp = [],[] for residue_group in hierarchy.models()[0].chains()[0].residue_groups(): for atom_group in residue_group.atom_groups(): for atom in atom_group.atoms(): tmp.append( atom.xyz ) res_lst.append([residue_group.resseq_as_int(), tmp]) tmp=[] return res_lst
[docs]def xyz_cb_coordinates(pdbin): ''' Extract xyz for CA/CB atoms ''' pdb_input = iotbx.pdb.pdb_input(file_name=pdbin) hierarchy = pdb_input.construct_hierarchy() res_dict = _xyz_cb_coordinates(hierarchy) cb_lst = [] for i in xrange(len(res_dict)): if len(res_dict[i]) > 1: cb_lst.append(res_dict[i][1]) elif len(res_dict[i]) == 1: cb_lst.append(res_dict[i][0]) return cb_lst
def _xyz_cb_coordinates(hierarchy): res_lst = [] for residue_group in hierarchy.models()[0].chains()[0].residue_groups(): for atom_group in residue_group.atom_groups(): xyz_lst = _xyz_atom_coords(atom_group) res_lst.append([residue_group.resseq_as_int(), xyz_lst]) return res_lst def _xyz_atom_coords(atom_group): ''' Use this method if you need to identify if CB is present in atom_group and if not return CA ''' tmp_dict = {} for atom in atom_group.atoms(): if atom.name.strip() in set(["CA", "CB"]): tmp_dict[atom.name.strip()] = atom.xyz if 'CB' in tmp_dict: return tmp_dict['CB'] elif 'CA' in tmp_dict: return tmp_dict['CA'] else: return (float('inf'), float('inf'), float('inf'))
[docs]class Test(unittest.TestCase):
[docs] @classmethod def setUpClass(cls): """ Set up paths. Need to do this with setUpClass, as otherwise the __file__ variable is updated whenever the cwd is changed in a test and the next test gets the wrong paths. """ cls.thisd = os.path.abspath( os.path.dirname( __file__ ) ) paths = cls.thisd.split( os.sep ) cls.ample_dir = os.sep.join( paths[ : -1 ] ) cls.tests_dir=os.path.join(cls.ample_dir,"tests") cls.testfiles_dir = os.path.join(cls.tests_dir,'testfiles') return
[docs] def testGetInfo1(self): """""" pdbfile = os.path.join(self.testfiles_dir,"1GU8.pdb") info = get_info( pdbfile ) self.assertEqual( info.pdbCode, "1GU8" ) self.assertEqual( len(info.models), 2 ) m1 = info.models[0] self.assertEqual( m1.chains[0], 'A' ) self.assertEqual( m1.resSeqs[0], [2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 154, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164, 165, 166, 167, 168, 169, 170, 171, 172, 173, 174, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208, 209, 210, 211, 212, 213, 214, 215, 216, 217, 218, 219] ) self.assertEqual( m1.sequences[0], 'VGLTTLFWLGAIGMLVGTLAFAWAGRDAGSGERRYYVTLVGISGIAAVAYVVMALGVGWVPVAERTVFAPRYIDWILTTPLIVYFLGLLAGLDSREFGIVITLNTVVMLAGFAGAMVPGIERYALFGMGAVAFLGLVYYLVGPMTESASQRSSGIKSLYVRLRNLTVILWAIYPFIWLLGPPGVALLTPTVDVALIVYLDLVTKVGFGFIALDAAATL' ) self.assertEqual( m1.caMask[0], [ False ] * 218 ) self.assertEqual( m1.bbMask[0], [False, True, False, False, False, False, False, False, False, True, False, False, True, False, False, False, True, False, False, False, False, False, False, False, True, False, False, False, True, False, True, False, False, False, False, False, False, False, False, False, True, False, False, True, False, False, False, False, False, False, False, False, False, False, False, True, False, True, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, True, False, False, False, True, False, False, False, False, False, False, True, False, False, False, False, False, False, False, False, False, False, False, False, True, False, False, True, False, False, False, False, True, False, False, False, False, False, False, False, True, False, True, False, False, False, False, False, True, False, False, False, False, False, False, True, False, False, False, False, False, False, False, False, False, False, False, True, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, True, False, False, True, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, True, False, True, False, False, False, False, False, False, False, False, False, True] ) self.assertEqual( info.numAtoms( modelIdx=0 ), 1621 ) self.assertEqual( info.numCalpha( modelIdx=0 ), 218 ) m2 = info.models[1] self.assertEqual( m2.chains[0], 'A' ) self.assertEqual( m2.resSeqs[0], [2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 154, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164, 165, 166, 167, 168, 169, 170, 171, 172, 173, 174, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208, 209, 210, 211, 212, 213, 214, 215, 216, 217, 218, 219] ) self.assertEqual( m2.sequences[0], 'VGLTTLFWLGAIGMLVGTLAFAWAGRDAGSGERRYYVTLVGISGIAAVAYVVMALGVGWVPVAERTVFAPRYIDWILTTPLIVYFLGLLAGLDSREFGIVITLNTVVMLAGFAGAMVPGIERYALFGMGAVAFLGLVYYLVGPMTESASQRSSGIKSLYVRLRNLTVILWAIYPFIWLLGPPGVALLTPTVDVALIVYLDLVTKVGFGFIALDAAATL' ) self.assertEqual( info.numAtoms( modelIdx=1 ), 1621 ) self.assertEqual( info.numCalpha( modelIdx=1 ), 218 ) return
[docs] def testGetInfo2(self): """""" pdbfile = os.path.join(self.testfiles_dir,"2UUI.pdb") info = get_info( pdbfile ) self.assertEqual( len(info.models), 1 ) m1 = info.models[0] self.assertEqual( m1.chains[0], 'A' ) self.assertEqual( m1.resSeqs[0], [ i for i in range(-5,150) ] ) self.assertEqual( m1.sequences[0], 'MHHHHHHKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPW' ) self.assertEqual( m1.caMask[0], [ False ] * 154 + [ True ] ) self.assertEqual( m1.bbMask[0], [False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, True, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, True, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, True, False, False, False, False, False, True, False, False, False, False, False, True, False, False, False, False, False, False, False, False, False, False, False, False, True, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, True, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, True, False, False, False, False, True, True, True, True] ) self.assertEqual( info.numAtoms( modelIdx=0 ), 1263 ) return
[docs] def testCheckPdbs(self): logging.basicConfig() logging.getLogger().setLevel(logging.DEBUG) pdbs=glob.glob(os.path.join(self.testfiles_dir,"models","*.pdb")) self.assertTrue(check_pdbs(pdbs)) self.assertFalse(check_pdbs(pdbs, single=True,sequence="AABBCC")) pdbs += [ os.path.join(self.testfiles_dir,"1GU8.pdb") ] self.assertFalse(check_pdbs(pdbs,single=True,sequence="AABBCC")) return
[docs] def testSelectResidues(self): pdbin = os.path.join(self.testfiles_dir,"4DZN.pdb") pdbout = "testSelectResidues1.pdb" to_delete = [5,10,15,20] b4 = set(resseq(pdbin)['A']) select_residues(pdbin=pdbin, pdbout=pdbout, delete=to_delete) after = set(resseq(pdbout)['A']) self.assertEqual(after,b4.difference(set(to_delete))) os.unlink(pdbout) return
[docs] def testSelectResiduesKeepIdxs(self): pdbin = os.path.join(self.testfiles_dir,"4DZN.pdb") pdbout = "testSelectResidues2.pdb" tokeep_idx = [0,5,10,15,20] b4 = [ r for i,r in enumerate(resseq(pdbin)['A']) if i in tokeep_idx ] select_residues(pdbin=pdbin, pdbout=pdbout, tokeep_idx=tokeep_idx) #hierachy=iotbx.pdb.pdb_input(pdbout).construct_hierarchy() #print [a.name for a in hierachy.models()[0].chains()[0].atoms() ] #print "GOT ",resseq(pdbout) after = resseq(pdbout)['A'] self.assertEqual(after,b4) os.unlink(pdbout) return
[docs] def testSequence1(self): pdbin=os.path.join(self.testfiles_dir,"4DZN.pdb") ref={ 'A' :'GEIAALKQEIAALKKEIAALKEIAALKQGYY', 'B' : 'GEIAALKQEIAALKKEIAALKEIAALKQGYY', 'C' : 'GEIAALKQEIAALKKEIAALKEIAALKQGYY' } s=sequence(pdbin) self.assertEqual(ref, s, "Bad _sequecne: {0}".format(s)) return
[docs] def XtestSplit(self): pdbin=os.path.join(self.testfiles_dir,"1GU8.pdb") Xsplit(pdbin) #os.unlink(pdbout) return
[docs] def testStdResidues(self): pdbin=os.path.join(self.testfiles_dir,"4DZN.pdb") pdbout="std.pdb" std_residues_cctbx(pdbin, pdbout) # Check it's valid pdb_obj = iotbx.pdb.hierarchy.input(file_name=pdbout) #Get list of all the residue names in chain 1 resnames=[g.unique_resnames()[0] for g in pdb_obj.hierarchy.models()[0].chains()[0].residue_groups()] ref=['ACE', 'GLY', 'GLU', 'ILE', 'ALA', 'ALA', 'LEU', 'LYS', 'GLN', 'GLU', 'ILE', 'ALA', 'ALA', 'LEU', 'LYS', 'LYS', 'GLU', 'ILE', 'ALA', 'ALA', 'LEU', 'LYS', 'PHE', 'GLU', 'ILE', 'ALA', 'ALA', 'LEU', 'LYS', 'GLN', 'GLY', 'TYR', 'TYR'] self.assertEqual(resnames,ref) os.unlink(pdbout) return
[docs] def testStdResiduesCctbx(self): pdbin=os.path.join(self.testfiles_dir,"4DZN.pdb") pdbout="std.pdb" std_residues_cctbx(pdbin, pdbout) # Check it's valid pdb_obj = iotbx.pdb.hierarchy.input(file_name=pdbout) #Get list of all the residue names in chain 1 resnames=[g.unique_resnames()[0] for g in pdb_obj.hierarchy.models()[0].chains()[0].residue_groups()] ref=['ACE', 'GLY', 'GLU', 'ILE', 'ALA', 'ALA', 'LEU', 'LYS', 'GLN', 'GLU', 'ILE', 'ALA', 'ALA', 'LEU', 'LYS', 'LYS', 'GLU', 'ILE', 'ALA', 'ALA', 'LEU', 'LYS', 'PHE', 'GLU', 'ILE', 'ALA', 'ALA', 'LEU', 'LYS', 'GLN', 'GLY', 'TYR', 'TYR'] self.assertEqual(resnames,ref) os.unlink(pdbout) return
[docs] def testStripHetatm(self): pdbin = os.path.join(self.testfiles_dir,"1BYZ.pdb") pdbout='strip_het.pdb' hierachy = iotbx.pdb.pdb_input(pdbin).construct_hierarchy() _strip(hierachy, hetatm=True, hydrogen=False) hierachy.write_pdb_file(pdbout,anisou=False) with open(pdbout) as f: got = any([ True for l in f.readlines() if l.startswith('HETATM') ]) self.assertFalse(got, "Found HETATMS") os.unlink(pdbout) return
[docs] def testStripHydrogen(self): pdbin = os.path.join(self.testfiles_dir,"1BYZ.pdb") pdbout='strip_H.pdb' hierachy = iotbx.pdb.pdb_input(pdbin).construct_hierarchy() _strip(hierachy, hetatm=False, hydrogen=True) hierachy.write_pdb_file(pdbout,anisou=False) with open(pdbout) as f: got = any([ True for l in f.readlines() if l.startswith('ATOM') and l[13] == 'H' ]) self.assertFalse(got, "Found Hydrogens") os.unlink(pdbout) return
[docs] def testStripAtomTypes(self): pdbin = os.path.join(self.testfiles_dir,"1BYZ.pdb") pdbout='strip_types.pdb' hierachy = iotbx.pdb.pdb_input(pdbin).construct_hierarchy() _strip(hierachy, hetatm=False, hydrogen=False, atom_types=['CB']) hierachy.write_pdb_file(pdbout,anisou=False) with open(pdbout) as f: got = any([ True for l in f.readlines() if l.startswith('ATOM') and l[12:15].strip() == 'CB' ]) self.assertFalse(got, "Found Atom Types") os.unlink(pdbout) return
[docs] def testReliableSidechains(self): pdbin=os.path.join(self.testfiles_dir,"1GU8.pdb") pdbout="std.pdb" reliable_sidechains(pdbin, pdbout) # Check it's valid pdb_obj = iotbx.pdb.hierarchy.input(file_name=pdbout) #Get list of all the residue names in chain 1 resnames=[g.unique_resnames()[0] for g in pdb_obj.hierarchy.models()[0].chains()[0].residue_groups()] ref=['VAL', 'GLY', 'LEU', 'THR', 'THR', 'LEU', 'PHE', 'TRP', 'LEU', 'GLY', 'ALA', 'ILE', 'GLY', 'MET', 'LEU', 'VAL', 'GLY', 'THR', 'LEU', 'ALA', 'PHE', 'ALA', 'TRP', 'ALA', 'GLY', 'ARG', 'ASP', 'ALA', 'GLY', 'SER', 'GLY', 'GLU', 'ARG', 'ARG', 'TYR', 'TYR', 'VAL', 'THR', 'LEU', 'VAL', 'GLY', 'ILE', 'SER', 'GLY', 'ILE', 'ALA', 'ALA', 'VAL', 'ALA', 'TYR', 'VAL', 'VAL', 'MET', 'ALA', 'LEU', 'GLY', 'VAL', 'GLY', 'TRP', 'VAL', 'PRO', 'VAL', 'ALA', 'GLU', 'ARG', 'THR', 'VAL', 'PHE', 'ALA', 'PRO', 'ARG', 'TYR', 'ILE', 'ASP', 'TRP', 'ILE', 'LEU', 'THR', 'THR', 'PRO', 'LEU', 'ILE', 'VAL', 'TYR', 'PHE', 'LEU', 'GLY', 'LEU', 'LEU', 'ALA', 'GLY', 'LEU', 'ASP', 'SER', 'ARG', 'GLU', 'PHE', 'GLY', 'ILE', 'VAL', 'ILE', 'THR', 'LEU', 'ASN', 'THR', 'VAL', 'VAL', 'MET', 'LEU', 'ALA', 'GLY', 'PHE', 'ALA', 'GLY', 'ALA', 'MET', 'VAL', 'PRO', 'GLY', 'ILE', 'GLU', 'ARG', 'TYR', 'ALA', 'LEU', 'PHE', 'GLY', 'MET', 'GLY', 'ALA', 'VAL', 'ALA', 'PHE', 'LEU', 'GLY', 'LEU', 'VAL', 'TYR', 'TYR', 'LEU', 'VAL', 'GLY', 'PRO', 'MET', 'THR', 'GLU', 'SER', 'ALA', 'SER', 'GLN', 'ARG', 'SER', 'SER', 'GLY', 'ILE', 'LYS', 'SER', 'LEU', 'TYR', 'VAL', 'ARG', 'LEU', 'ARG', 'ASN', 'LEU', 'THR', 'VAL', 'ILE', 'LEU', 'TRP', 'ALA', 'ILE', 'TYR', 'PRO', 'PHE', 'ILE', 'TRP', 'LEU', 'LEU', 'GLY', 'PRO', 'PRO', 'GLY', 'VAL', 'ALA', 'LEU', 'LEU', 'THR', 'PRO', 'THR', 'VAL', 'ASP', 'VAL', 'ALA', 'LEU', 'ILE', 'VAL', 'TYR', 'LEU', 'ASP', 'LEU', 'VAL', 'THR', 'LYS', 'VAL', 'GLY', 'PHE', 'GLY', 'PHE', 'ILE', 'ALA', 'LEU', 'ASP', 'ALA', 'ALA', 'ALA', 'THR', 'LEU'] self.assertEqual(resnames,ref) reliable_sidechains_cctbx(pdbin, pdbout) pdb_obj = iotbx.pdb.hierarchy.input(file_name=pdbout) self.assertEqual(resnames,ref) os.unlink(pdbout) return
[docs] def testXyzCoordinates(self): pdbin=os.path.join(self.testfiles_dir,"4DZN.pdb") test_hierarchy = iotbx.pdb.pdb_input( file_name=pdbin ).construct_hierarchy() xyz_lst = _xyz_coordinates( test_hierarchy ) ref_data_start = [(0, [( 25.199, 11.913, -9.25), ( 25.201, 10.666, -9.372), ( 26.454, 12.702, -9.001)]), (1, [( 24.076, 12.643, -9.179), ( 22.806, 12.124, -9.698), ( 22.170, 11.067, -8.799), ( 22.404, 11.024, -7.580)]), (2, [( 21.377, 10.190, -9.397), ( 20.675, 9.156, -8.637), ( 21.614, 8.106, -7.996), ( 21.337, 7.619, -6.898), ( 19.625, 8.485, -9.531), ( 18.637, 7.595, -8.790), ( 17.652, 8.361, -7.951), ( 17.724, 9.603, -7.887), ( 16.786, 7.706, -7.365)])] for idx in xrange(len( ref_data_start )): # Stuff that needs to be true self.assertEqual( ref_data_start[idx][0], xyz_lst[idx][0] ) self.assertSequenceEqual(ref_data_start[idx][1], xyz_lst[idx][1] ) nr_atoms = sum(len(i[1]) for i in xyz_lst) self.assertEqual(252, nr_atoms) self.assertEqual(35, len(xyz_lst))
[docs] def testXyzCbCoordinates(self): pdbin=os.path.join(self.testfiles_dir,"4DZN.pdb") test_hierarchy = iotbx.pdb.pdb_input(file_name=pdbin).construct_hierarchy() xyz_cb_lst = _xyz_cb_coordinates(test_hierarchy) ref_data_start = [(0,(float('inf'), float('inf'), float('inf'))), (1,(22.806, 12.124, -9.698)), (2,(19.625, 8.485, -9.531)), (3,(24.783, 6.398, -9.051)), (4,(25.599, 10.846, -6.036)), (5,(20.430, 10.143, -4.644))] self.assertSequenceEqual(ref_data_start[1], xyz_cb_lst[1][:6]) self.assertEqual(35, len(xyz_cb_lst))
if __name__ == "__main__": #unittest.TextTestRunner(verbosity=2).run(testSuite()) # # Command-line handling # #unittest.TextTestRunner(verbosity=2).run(testSuite()) import argparse parser = argparse.ArgumentParser(description='Manipulate PDB files', prefix_chars="-") group = parser.add_mutually_exclusive_group() group.add_argument('-ren', action='store_true', help="Renumber the PDB") group.add_argument('-std', action='store_true', help='Standardise the PDB') group.add_argument('-seq', action='store_true', help='Write a fasta of the found AA to stdout') group.add_argument('-split_models', action='store_true', help='Split a pdb into constituent models') group.add_argument('-split_chains', action='store_true', help='Split a pdb into constituent chains') parser.add_argument('input_file', #nargs='?', help='The input file - will not be altered') parser.add_argument('-o', dest='output_file', help='The output file - will be created') parser.add_argument('-chain', help='The chain to use') parser.add_argument('-test', action='store_true', help='Run unittests') args = parser.parse_args() if args.test: print unittest.TestLoader().loadTestsFromModule(sys.modules[__name__]) sys.exit(unittest.TextTestRunner().run(unittest.TestLoader().loadTestsFromModule(sys.modules[__name__]))) # Get full paths to all files args.input_file = os.path.abspath(args.input_file) if not os.path.isfile(args.input_file): raise RuntimeError, "Cannot find input file: {0}".format(args.input_file) if args.output_file: args.output_file = os.path.abspath(args.output_file) else: n = os.path.splitext( os.path.basename(args.input_file))[0] args.output_file = n+"_std.pdb" if args.ren: renumber_residues(args.input_file, args.output_file, start=1) elif args.std: standardise(args.input_file, args.output_file, del_hetatm=True, chain=args.chain) elif args.seq: print sequence_util.Sequence(pdb=args.input_file).fasta_str() elif args.split_models: print split_pdb(args.input_file) elif args.split_chains: print split_into_chains(args.input_file, chain=args.chain)