#!/usr/bin/env ccp4-python
'''
Useful manipulations on PDB files
'''
# Python imports
import copy
import glob
import logging
import os
import re
import sys
import unittest
import iotbx.file_reader
import iotbx.pdb
#iotbx.pdb.amino_acid_codes.one_letter_given_three_letter
import ample_util
import pdb_model
import residue_map
import sequence_util
three2one = {
'ALA' : 'A',
'ARG' : 'R',
'ASN' : 'N',
'ASP' : 'D',
'CYS' : 'C',
'GLU' : 'E',
'GLN' : 'Q',
'GLY' : 'G',
'HIS' : 'H',
'ILE' : 'I',
'LEU' : 'L',
'LYS' : 'K',
'MET' : 'M',
'PHE' : 'F',
'PRO' : 'P',
'SER' : 'S',
'THR' : 'T',
'TRP' : 'W',
'TYR' : 'Y',
'VAL' : 'V',
'UNK' : 'X'
}
# http://stackoverflow.com/questions/3318625/efficient-bidirectional-hash-table-in-python
#aaDict.update( dict((v, k) for (k, v) in aaDict.items()) )
one2three = dict((v, k) for (k, v) in three2one.items())
_logger = logging.getLogger()
[docs]def backbone(inpath=None, outpath=None):
"""Only output backbone atoms.
"""
# pdbcur segfaults with long pathnames
inpath=os.path.relpath(inpath)
outpath=os.path.relpath(outpath)
logfile = outpath+".log"
cmd="pdbcur xyzin {0} xyzout {1}".format( inpath, outpath ).split()
# Build up stdin
stdin='lvatom "N,CA,C,O,CB[N,C,O]"'
#stdin='lvatom "N,CA,C,O[N,C,O]"'
retcode = ample_util.run_command(cmd=cmd, logfile=logfile, directory=os.getcwd(), dolog=False, stdin=stdin)
if retcode == 0:
# remove temporary files
os.unlink(logfile)
else:
raise RuntimeError,"Error stripping PDB to backbone atoms. See log:{0}".format(logfile)
return
[docs]def calpha_only(inpdb, outpdb):
"""Strip PDB to c-alphas only"""
logfile = outpdb+".log"
cmd="pdbcur xyzin {0} xyzout {1}".format( inpdb, outpdb ).split()
# Build up stdin
stdin='lvatom "CA[C]:*"'
retcode = ample_util.run_command(cmd=cmd, logfile=logfile, directory=os.getcwd(), dolog=False, stdin=stdin)
if retcode == 0:
# remove temporary files
os.unlink(logfile)
else:
raise RuntimeError,"Error stripping PDB to c-alpha atoms"
return
# def cat_pdbs( pdb1=None, pdb2=None, pdbout=None ):
# """Concatenate 2 pdbs into a single file. The header from the first is kept and
# the chains from the second added to the end of the first
# """
#
# one = open( pdb1, 'r' )
# lines = []
#
# needTer=True
# for line in one:
# lines.append( line )
# if line.startswith("TER"):
# needTer=False
# break
# one.close()
#
# if needTer:
# lines.append( "TER\n" )
#
# needTer=True
# two = open( pdb2, 'r' )
# for line in two:
# if line.startswith("ATOM"):
# lines.append( line )
# continue
#
# if line.startswith("TER"):
# lines.append( line )
# needTer=False
# break
# two.close()
#
# if needTer:
# lines.append( "TER\n" )
#
# lines.append("END\n")
#
# # Now write 'em out
# with open( pdbout, 'w') as o:
# o.writelines( lines )
#
# return
[docs]def check_pdb_directory(directory,single=True,allsame=True,sequence=None):
_logger.info("Checking pdbs in directory: {0}".format(directory))
if not os.path.isdir(directory):
_logger.critical("Cannot find directory: {0}".format(directory))
return False
models=glob.glob(os.path.join(directory,"*.pdb"))
if not len(models):
_logger.critical("Cannot find any pdb files in directory: {0}".format(directory))
return False
if not (single or sequence or allsame): return True
return check_pdbs(models,sequence=sequence,single=single,allsame=allsame)
[docs]def check_pdbs(models,single=True,allsame=True,sequence=None):
if allsame and not sequence:
# Get sequence from first model
try:
h=iotbx.pdb.pdb_input(models[0]).construct_hierarchy()
except Exception,e:
s="*** ERROR reading sequence from first pdb: {0}\n{1}".format(models[0],e)
_logger.critical(s)
return False
sequence = _sequence1(h) # only one model/chain
errors = []
multi = []
no_protein = []
sequence_err = []
unnamed_chain = []
for pdb in models:
try:
h = iotbx.pdb.pdb_input(pdb).construct_hierarchy()
except Exception,e:
errors.append((pdb,e))
continue
if not single: continue
if not (h.models_size()==1 and h.models()[0].chains_size()==1):
multi.append(pdb)
continue
# single chain from one model so check is protein
if not h.models()[0].chains()[0].is_protein():
no_protein.append(pdb)
continue
if not h.models()[0].chains()[0].id.strip(): # Check we have a named chain
unnamed_chain.append(pdb)
continue
if sequence:
s=_sequence1(h) # only one chain/model
if not s == sequence: sequence_err.append((pdb,s))
if not (len(errors) or len(multi) or len(sequence_err) or len(no_protein) or len(unnamed_chain)):
_logger.info("check_pdb_directory - pdb files all seem valid")
return True
s="\n"
if len(errors):
s="*** ERROR ***\n"
s+="The following pdb files have errors:\n\n"
for pdb,e in errors:
s+="{0}: {1}\n".format(pdb,e)
if len(multi):
s+="\n"
s+="The following pdb files have more than one chain:\n\n"
for pdb in multi:
s+="{0}\n".format(pdb)
if len(no_protein):
s+="\n"
s+="The following pdb files do not appear to contain any protein:\n\n"
for pdb in no_protein:
s+="{0}\n".format(pdb)
if len(unnamed_chain):
s+="\n"
s+="The following pdb files do not have named chains:\n\n"
for pdb in unnamed_chain:
s+="{0}\n".format(pdb)
if len(sequence_err):
s+="\n"
s+="The following pdb files have differing sequences from the reference sequence:\n\n{0}\n\n".format(sequence)
for pdb,seq in sequence_err:
s+="PDB: {0}\n{1}\n".format(pdb,seq)
_logger.critical(s)
return False
# def get_resseq_map(nativePdb, modelPdb ):
# """Return a ResSeqMap mapping the index of a residue in the model to the corresponding residue in the native.
# Only works if 1 chain in either file and with standard residues
# """
#
# def _get_indices( pdb ):
# """Get fastaSequence as string of 1AA
# get list of matching resSeq
# """
#
#
# print "GETTING INDICES ",pdb
#
# fastaSequence = ""
# resSeq = []
#
# atomTypes = [] # For checking we have all required atom types
# backbone = [ 'N', 'CA', 'C', 'O','CB' ]
#
# backboneMask = []
# cAlphaMask = []
#
# chain=None
# readingResSeq=None
# readingResName=None
# for line in open( pdb ):
#
# if line.startswith("MODEL"):
# raise RuntimeError,"FOUND MULTI_MODEL FILE!"
#
# if line.startswith("ATOM"):
#
# atom = pdb_model.PdbAtom( line )
#
# if not chain:
# chain = atom.chainID
#
# if atom.chainID != chain:
# raise RuntimeError," FOUND ADDITIONAL CHAIN"
# break
#
# if atom.name not in atomTypes:
# atomTypes.append( atom.name.strip() )
#
# # First atom in first residue
# if readingResSeq == None:
# readingResSeq = atom.resSeq
# readingResName = atom.resName
# continue
#
# if readingResSeq != atom.resSeq:
# # Adding a new residue
#
#
#
#
# # Add the atom we've just finished reading
# fastaSequence += three2one[ readingResName ]
# resSeq.append( readingResSeq )
#
# got=False
# if 'CA' not in atomTypes:
# cAlphaMask.append( True )
# got=True
# else:
# cAlphaMask.append( False )
#
#
# if not got: # If we haven't got CA we don't need to check
# for at in backbone: # If we need to mask this residue for backbone atoms
# if at not in atomTypes:
# got=True
# break
# #s = "Atom type {0} is not present in atom types for residue {1} - only got atomTypes: {2}".format( at, readingResSeq, atomTypes )
# #print s
#
# if got:
# backboneMask.append( True )
# else:
# backboneMask.append( False )
#
#
# readingResSeq = atom.resSeq
# readingResName = atom.resName
# atomTypes = []
#
# return ( fastaSequence, resSeq, cAlphaMask, backboneMask )
#
# native_seq, native_idx = _get_indices( nativePdb )
# model_seq, model_idx = _get_indices( modelPdb )
#
# # The window of AA we used to check for a match
# PROBE_LEN = 10
#
# if len(native_seq) < 20 or len(model_seq) < 20:
# raise RuntimeError,"Very short sequences - this will not work!"
#
# # MAXINSET is the max number of AA into the sequence that we will go searching for a match - i.e. if more
# # then MAXINSET AA are non-matching, we won't find the match
# #MAXINSET=30 if len( model_seq ) > 30 else len( model_seq ) - ( PROBE_LEN + 2)
# if len( model_seq ) > 30:
# MAXINSET=30
# else:
# MAXINSET = len( model_seq ) - ( PROBE_LEN + 2)
#
# got=False
# for model_i in range( MAXINSET ):
# probe = model_seq[ model_i : model_i+PROBE_LEN-1 ]
# for native_i in range( MAXINSET ):
# if native_seq[ native_i:native_i+PROBE_LEN-1 ] == probe:
# got=True
# break
#
# if got:
# #print "GOT MODEL MATCH AT i,j ",model_i,native_i
# break
#
# # Now we know where they start we can sort out the indicies
# # map goes from the model -> native. For any in model that are not in native we set them to None
# resMap = residueSequenceMap()
# resMap._modelResSeqMap = model_idx
#
# for i in range( len( model_seq ) ):
#
# if i < model_i:
# # These are residues that are present in the model but not in the native
# resMap._nativeResSeqMap.append( None )
# continue
#
# pos = i - model_i + native_i
# if pos >= len( native_idx ):
# resMap._nativeResSeqMap.append( None )
# else:
# resMap._nativeResSeqMap.append( native_idx[ pos ] )
#
#
# if resMap._nativeResSeqMap != resMap._modelResSeqMap:
# raise RuntimeError, "Mismatching maps: {0}".format( resMap )
#
# return resMap
[docs]def keep_matching(refpdb=None, targetpdb=None, outpdb=None, resSeqMap=None ):
"""Only keep those atoms in targetpdb that are in refpdb and write the result to outpdb.
We also take care of renaming any chains.
"""
assert refpdb and targetpdb and outpdb and resSeqMap
# Paranoid check
if False:
refinfo = get_info( refpdb )
targetinfo = get_info( targetpdb )
if len(refinfo.models) > 1 or len(targetinfo.models) > 1:
raise RuntimeError, "PDBS contain more than 1 model!"
if refinfo.models[0].chains != targetinfo.models[0].chains:
raise RuntimeError, "Different numbers/names of chains {0}->{1} between {2} and {3}!".format( refinfo.models[0].chains,
targetinfo.models[0].chains,
refpdb,
targetpdb
)
# Now we do our keep matching
tmp1 = ample_util.tmp_file_name()+".pdb" # pdbcur insists names have a .pdb suffix
_keep_matching( refpdb, targetpdb, tmp1, resSeqMap=resSeqMap )
# now renumber with pdbcur
logfile = tmp1+".log"
cmd="pdbcur xyzin {0} xyzout {1}".format( tmp1, outpdb ).split()
stdint="""sernum
"""
retcode = ample_util.run_command(cmd=cmd, logfile=logfile, directory=os.getcwd(), dolog=False, stdin=stdint)
if retcode == 0:
# remove temporary files
os.unlink(tmp1)
os.unlink(logfile)
return retcode
def _keep_matching(refpdb=None, targetpdb=None, outpdb=None, resSeqMap=None ):
"""Create a new pdb file that only contains that atoms in targetpdb that are
also in refpdb. It only considers ATOM lines and discards HETATM lines in the target.
Args:
refpdb: path to pdb that contains the minimal set of atoms we want to keep
targetpdb: path to the pdb that will be stripped of non-matching atoms
outpdb: output path for the stripped pdb
"""
assert refpdb and targetpdb and outpdb and resSeqMap
def _output_residue(refResidues, targetAtomList, resSeqMap, outfh):
"""Output a single residue only outputting matching atoms, shuffling the atom order and changing the resSeq num"""
# Get the matching list of atoms
targetResSeq = targetAtomList[0].resSeq
refResSeq = resSeqMap.ref2target( targetResSeq )
# Get the atomlist for the reference
for ( rid, alist ) in refResidues:
if rid == refResSeq:
refAtomList = alist
break
# Get ordered list of the ref atom names for this residue
rnames = [ x.name for x in refAtomList ]
#print "got rnames ",rnames
#print "got anames ", [ x.name for x in targetAtomList ]
if len( refAtomList ) > len( targetAtomList ):
s = "Cannot keep matching as refAtomList is > targetAtomList for residue {0}\nRef: {1}\nTrg: {2}".format( targetResSeq,
rnames,
[ x.name for x in targetAtomList ]
)
raise RuntimeError, s
# Remove any not matching in the target
alist = []
for atom in targetAtomList:
if atom.name in rnames:
alist.append( atom )
# List now only contains matching atoms
targetAtomList = alist
#print "tnames ",[ x.name for x in targetAtomList ]
# Now just have matching so output in the correct order
for refname in rnames:
for i,atom in enumerate( targetAtomList ):
if atom.name == refname:
# Found the matching atom
# Change resSeq and write out
atom.resSeq = refResSeq
outfh.write( atom.toLine()+"\n" )
# now delete both this atom and the line
targetAtomList.pop(i)
# jump out of inner loop
break
return
# Go through refpdb and find which refResidues are present
refResidues = []
targetResSeq = [] # ordered list of tuples - ( resSeq, [ list_of_atoms_for_that_residue ] )
last = None
chain = -1
for line in open(refpdb, 'r'):
if line.startswith("MODEL"):
raise RuntimeError, "Multi-model file!"
if line.startswith("TER"):
break
if line.startswith("ATOM"):
a = pdb_model.PdbAtom( line )
# First atom/chain
if chain == -1:
chain = a.chainID
if a.chainID != chain:
raise RuntimeError, "ENCOUNTERED ANOTHER CHAIN! {0}".format( line )
if a.resSeq != last:
last = a.resSeq
# Add the corresponding resSeq in the target
targetResSeq.append( resSeqMap.target2ref( a.resSeq ) )
refResidues.append( ( a.resSeq, [ a ] ) )
else:
refResidues[ -1 ][ 1 ].append( a )
# Now read in target pdb and output everything bar the atoms in this file that
# don't match those in the refpdb
t = open(targetpdb,'r')
out = open(outpdb,'w')
chain=None # The chain we're reading
residue=None # the residue we're reading
targetAtomList = []
for line in t:
if line.startswith("MODEL"):
raise RuntimeError, "Multi-model file!"
if line.startswith("ANISOU"):
raise RuntimeError, "I cannot cope with ANISOU! {0}".format(line)
# Stop at TER
if line.startswith("TER"):
_output_residue( refResidues, targetAtomList, resSeqMap, out )
# we write out our own TER
out.write("TER\n")
continue
if line.startswith("ATOM"):
atom = pdb_model.PdbAtom( line )
# First atom/chain
if chain == None:
chain = atom.chainID
if atom.chainID != chain:
raise RuntimeError, "ENCOUNTERED ANOTHER CHAIN! {0}".format( line )
if atom.resSeq in targetResSeq:
# If this is the first one add the empty tuple and reset residue
if atom.resSeq != residue:
if residue != None: # Dont' write out owt for first atom
_output_residue( refResidues, targetAtomList, resSeqMap, out )
targetAtomList = []
residue = atom.resSeq
# If not first keep adding
targetAtomList.append( atom )
# We don't write these out as we write them with _output_residue
continue
else:
# discard this line as not a matching atom
continue
# For time being exclude all HETATM lines
elif line.startswith("HETATM"):
continue
#Endif line.startswith("ATOM")
# Output everything else
out.write(line)
# End reading loop
t.close()
out.close()
return
# OLD STUFF FOR MULTIPLE CHAINS AND WITHOUT THE residueSequenceMap
# def _keep_matching(refpdb=None, targetpdb=None, outpdb=None ):
# """Create a new pdb file that only contains that atoms in targetpdb that are
# also in refpdb. It only considers ATOM lines and discards HETATM lines in the target.
#
# Args:
# refpdb: path to pdb that contains the minimal set of atoms we want to keep
# targetpdb: path to the pdb that will be stripped of non-matching atoms
# outpdb: output path for the stripped pdb
# """
#
# assert refpdb and targetpdb and outpdb
#
# def _write_matching_residues( chain, refResidues, target_residues, outfh ):
#
# #print "got target_residues: {0}".format(target_residues)
#
# # Loop over each residue in turn
# for idx, atoms_and_lines in sorted( target_residues[ chain ].items() ):
#
# # Get ordered list of the ref atom names for this residue
# rnames = [ x.name for x in refResidues[ chain ][ idx ] ]
#
# #print "rnames ",rnames
#
# # Remove any not matching
# atoms = []
# atom_lines = []
# for i, a in enumerate( atoms_and_lines[0] ):
# if a.name in rnames:
# atoms.append( atoms_and_lines[0][i] )
# atom_lines.append( atoms_and_lines[1][i] )
#
#
# # Now just have matching so output in the correct order
# for refname in rnames:
# for i, atom in enumerate( atoms ):
# if atom.name == refname:
# # Found the matching atom so write out the corresponding line
# outfh.write( atom_lines[i] )
# # now delete both this atom and the line
# atoms.pop(i)
# atom_lines.pop(i)
# # jump out of inner loop
# break
#
# # We delete the chain we've written out so that we don't write it out again at the
# # end by mistake
# del refResidues[ chainIdx ]
# del target_residues[ chainIdx ]
# return
#
# # Go through refpdb and find which refResidues are present
# f = open(refpdb, 'r')
#
# # map of resSeq to list of PdbAtom objects for the reference residues
# refResidues = {}
#
# last = None
# chain = -1
# chainIdx=-1 # For the time being we key by the chain index so we can deal with
# # proteins that have different chain IDs
# for line in f:
# if line.startswith("MODEL"):
# raise RuntimeError, "Multi-model file!"
#
# if line.startswith("ATOM"):
# a = pdb_model.PdbAtom( line )
#
# if a.chainID != chain:
# chain = a.chainID
# chainIdx+=1
# if chainIdx in refResidues:
# raise RuntimeError, "ENCOUNTERED CHAIN AGAIN! {0}".format( line )
# refResidues[ chainIdx ] = {}
#
# if a.resSeq != last:
# #if a.resSeq in refResidues:
# # raise RuntimeError,"Multiple chains in pdb - found residue #: {0} again.".format(a.resSeq)
# last = a.resSeq
# #refResidues[ last ] = [ a ]
# refResidues[ chainIdx ][ last ] = [ a ]
# else:
# #refResidues[ last ].append( a )
# refResidues[ chainIdx ][ last ].append( a )
#
# f.close()
#
# #print "got refResidues: {0}".format(refResidues)
#
# # Now read in target pdb and output everything bar the atoms in this file that
# # don't match those in the refpdb
# t = open(targetpdb,'r')
# out = open(outpdb,'w')
#
# reading=-1 # The residue we are reading - set to -1 when we are not reading
# chain=-1 # The chain we're reading
# chainIdx=-1 # see above
#
# target_residues = {} # dict mapping residue index to a a tuple of (atoms, lines), where atoms is a list of the atom
# # objects and lines is a list of the lines used to create the atom objects
#
# for line in t:
#
# if line.startswith("MODEL"):
# raise RuntimeError, "Multi-model file!"
#
# if line.startswith("ANISOU"):
# raise RuntimeError, "I cannot cope with ANISOU! {0}".format(line)
#
# # Stop at TER
# if line.startswith("TER"):
# # we write out our own TER
# _write_matching_residues( chainIdx, refResidues, target_residues, out )
# out.write("TER\n")
# continue
#
# if line.startswith("ATOM"):
#
# atom = pdb_model.PdbAtom( line )
#
# # different/first chain
# if atom.chainID != chain:
# chain = atom.chainID
# chainIdx+=1
# if chainIdx in target_residues:
# raise RuntimeError, "ENCOUNTERED CHAIN IN TARGET AGAIN! {0}".format( line )
# target_residues[ chainIdx ] = {}
#
# # We copy resSeq to make sure we don't use a reference for our index
# resSeq = copy.copy( atom.resSeq )
#
# # Skip any refResidues that don't match
# if resSeq in refResidues[ chainIdx ]:
#
# # If this is the first one add the empty tuple and reset reading
# if reading != resSeq:
# # each tuple is a list of atom objects and lines
# target_residues[ chainIdx ][ resSeq ] = ( [], [] )
# reading = resSeq
#
# target_residues[ chainIdx ][ resSeq ][0].append( atom )
# target_residues[ chainIdx ][ resSeq ][1].append( line )
#
# # we don't write out any atom lines as they are either not matching or
# # we write out matching at the end
# continue
#
# # For time being exclude all HETATM lines
# elif line.startswith("HETATM"):
# continue
# #Endif line.startswith("ATOM")
#
# # Output everything else
# out.write(line)
#
# # End reading loop
#
# # For some PDBS there is no ending TER so we need to check if we've written this out yet or not
# if target_residues.has_key( chainIdx ):
# _write_matching_residues( chainIdx, refResidues, target_residues, out )
# out.write("TER\n\n")
#
# t.close()
# out.close()
#
# return
[docs]def get_info(inpath):
"""Read a PDB and extract as much information as possible into a PdbInfo object
"""
info = pdb_model.PdbInfo()
info.pdb = inpath
currentModel = None
currentChain = -1
modelAtoms = [] # list of models, each of which is a list of chains with the list of atoms
# Go through refpdb and find which ref_residues are present
f = open(inpath, 'r')
line = f.readline()
while line:
# First line of title
if line.startswith('HEADER'):
info.pdbCode = line[62:66].strip()
# First line of title
if line.startswith('TITLE') and not info.title:
info.title = line[10:-1].strip()
if line.startswith("REMARK"):
try:
numRemark = int(line[7:10])
except ValueError:
line=f.readline()
continue
# Resolution
if numRemark == 2:
line = f.readline()
if line.find("RESOLUTION") != -1:
try:
info.resolution = float( line[25:30] )
except ValueError:
# RESOLUTION. NOT APPLICABLE.
info.resolution=-1
# Get solvent content
if numRemark == 280:
maxread = 5
# Clunky - read up to maxread lines to see if we can get the information we're after
# We assume the floats are at the end of the lines
for _ in range( maxread ):
line = f.readline()
if line.find("SOLVENT CONTENT") != -1:
try:
info.solventContent = float( line.split()[-1] )
except ValueError:
# Leave as None
pass
if line.find("MATTHEWS COEFFICIENT") != -1:
try:
info.matthewsCoefficient = float( line.split()[-1] )
except ValueError:
# Leave as None
pass
#End REMARK
if line.startswith("CRYST1"):
try:
info.crystalInfo = pdb_model.CrystalInfo( line )
except ValueError,e:
# Bug in pdbset nukes the CRYST1 line so we need to catch this
print "ERROR READING CRYST1 LINE in file {0}\":{1}\"\n{2}".format(inpath,line.rstrip(),e)
info.crystalInfo=None
if line.startswith("MODEL"):
if currentModel:
# Need to make sure that we have an id if only 1 chain and none given
if len( currentModel.chains ) <= 1:
if currentModel.chains[0] == None:
currentModel.chains[0] = 'A'
info.models.append( currentModel )
# New/first model
currentModel = pdb_model.PdbModel()
# Get serial
currentModel.serial = int(line.split()[1])
currentChain = None
modelAtoms.append( [] )
# Count chains (could also check against the COMPND line if present?)
if line.startswith('ATOM'):
# Create atom object
atom = pdb_model.PdbAtom(line)
# Check for the first model
if not currentModel:
# This must be the first model and there should only be one
currentModel = pdb_model.PdbModel()
modelAtoms.append( [] )
if atom.chainID != currentChain:
currentChain = atom.chainID
currentModel.chains.append( currentChain )
modelAtoms[ -1 ].append( [] )
modelAtoms[ -1 ][-1].append( atom )
# Can ignore TER and ENDMDL for time being as we'll pick up changing chains anyway,
# and new models get picked up by the models line
line = f.readline()
# End while loop
# End of reading loop so add the last model to the list
info.models.append( currentModel )
f.close()
bbatoms = [ 'N','CA','C','O','CB' ]
# Now process the atoms
for modelIdx, model in enumerate( info.models ):
chainList = modelAtoms[ modelIdx ]
for chainIdx, atomList in enumerate( chainList ):
# Paranoid check
assert model.chains[ chainIdx ] == atomList[0].chainID
# Add list of atoms to model
model.atoms.append( atomList )
# Initialise new chain
currentResSeq = atomList[0].resSeq
currentResName = atomList[0].resName
model.resSeqs.append( [] )
model.sequences.append( "" )
model.caMask.append( [] )
model.bbMask.append( [] )
atomTypes = []
for i, atom in enumerate( atomList ):
aname = atom.name.strip()
if atom.resSeq != currentResSeq and i == len(atomList) -1 :
# Edge case - last residue containing one atom
atomTypes = [ aname ]
else:
if aname not in atomTypes:
atomTypes.append( aname )
if atom.resSeq != currentResSeq or i == len(atomList) -1 :
# End of reading the atoms for a residue
model.resSeqs[ chainIdx ].append( currentResSeq )
model.sequences[ chainIdx ] += three2one[ currentResName ]
if 'CA' not in atomTypes:
model.caMask[ chainIdx ].append( True )
else:
model.caMask[ chainIdx ].append( False )
missing=False
for bb in bbatoms:
if bb not in atomTypes:
missing=True
break
if missing:
model.bbMask[ chainIdx ].append( True )
else:
model.bbMask[ chainIdx ].append( False )
currentResSeq = atom.resSeq
currentResName = atom.resName
atomTypes = []
return info
[docs]def match_resseq(targetPdb=None, outPdb=None, resMap=None, sourcePdb=None ):
"""
"""
assert sourcePdb or resMap
assert not ( sourcePdb and resMap )
if not resMap:
resMap = residue_map.residueSequenceMap( targetPdb, sourcePdb )
target = open(targetPdb,'r')
out = open(outPdb,'w')
chain=None # The chain we're reading
residue=None # the residue we're reading
for line in target:
if line.startswith("MODEL"):
raise RuntimeError, "Multi-model file!"
if line.startswith("ANISOU"):
raise RuntimeError, "I cannot cope with ANISOU! {0}".format(line)
# Stop at TER
if line.startswith("TER"):
# we write out our own TER
#out.write("TER\n")
#break
pass
if line.startswith("ATOM"):
atom = pdb_model.PdbAtom( line )
# First atom/chain
if chain == None:
chain = atom.chainID
if atom.chainID != chain:
pass
#raise RuntimeError, "ENCOUNTERED ANOTHER CHAIN! {0}".format( line )
# Get the matching resSeq for the model
modelResSeq = resMap.ref2target( atom.resSeq )
if modelResSeq == atom.resSeq:
out.write( line )
else:
atom.resSeq = modelResSeq
out.write( atom.toLine()+"\n" )
continue
#Endif line.startswith("ATOM")
# Output everything else
out.write(line)
# End reading loop
target.close()
out.close()
return
# def match_resseq(self, targetPdb, sourcePdb, keepAtoms="all", workdir=None, resSeqMap=None ):
# """Given a native pdb file and a model pdb file, create a copy of the native that can be directly compared with the model
#
# args:
# targetPdb:
# sourcePdb:
# keepAtoms: all, backbone or calpha - the atoms which are to be kept for the comparision
#
# """
#
# if not workdir:
# workdir = os.curdir()
#
# if not resSeqMap:
# # Calculate the RefSeqMap - need to do this before we reduce to c-alphas
# resSeqMap = residue_map.residueSequenceMap( targetPdb, sourcePdb )
#
# # Find out if there are atoms in the model that we need to remove
# modelIncomparable = resSeqMap.modelIncomparable()
# if len( modelIncomparable ):
#
# n = os.path.splitext( os.path.basename( targetPdb ) )[0]
# nativePdbCut = os.path.join( workdir, n+"_cut.pdb" )
#
# logfile = "{0}.log".format( nativePdbCut )
# cmd="pdbcur xyzin {0} xyzout {1}".format( targetPdb, nativePdbCut ).split()
#
# # Build up stdin - I'm too thick to work out the selection syntax for a discrete list
# stdin = ""
# for e in modelIncomparable:
# stdin += "delresidue {0}\n".format( e )
#
# retcode = ample_util.run_command(cmd=cmd, logfile=logfile, directory=workdir, dolog=False, stdin=stdin)
#
# if retcode == 0:
# # remove temporary files
# os.unlink(logfile)
# else:
# raise RuntimeError,"Error deleting residues {0}".format( modelIncomparable )
#
# targetPdb = nativePdbCut
#
#
# if keepAtoms == "calpha":
# # If only alpha atoms are required, we create a copy of the model with only alpha atoms
# n = os.path.splitext( os.path.basename( targetPdb ) )[0]
# tmp = os.path.join( workdir, n+"_cAlphaOnly.pdb" )
# calpha_only( targetPdb, tmp )
# targetPdb = tmp
# elif keepAtoms == "backbone":
# # Strip down to backbone atoms
# n = os.path.splitext( os.path.basename( targetPdb ) )[0]
# tmp = os.path.join( workdir, n+"_backbone.pdb" )
# backbone( targetPdb, tmp )
# targetPdb = tmp
# elif keepAtoms == "all":
# pass
# else:
# raise RuntimeError,"Unrecognised keepAtoms: {0}".format( keepAtoms )
#
# # Now create a PDB with the matching atoms from native that are in refined
# n = os.path.splitext( os.path.basename( targetPdb ) )[0]
# nativePdbMatch = os.path.join( workdir, n+"_matched.pdb" )
# keep_matching( refpdb=refinedPdb, targetpdb=targetPdb, outpdb=nativePdbMatch, resSeqMap=resSeqMap )
#
# return
[docs]def merge(pdb1=None, pdb2=None, pdbout=None ):
"""Merge two pdb files into one"""
logfile = pdbout+".log"
cmd=[ 'pdb_merge', 'xyzin1', pdb1, 'xyzin2', pdb2, 'xyzout', pdbout ]
# Build up stdin
stdin='nomerge'
retcode = ample_util.run_command(cmd=cmd, logfile=logfile, directory=os.getcwd(), dolog=False, stdin=stdin)
if retcode == 0:
# remove temporary files
os.unlink(logfile)
else:
raise RuntimeError,"Error merging pdbs: {0} {1}".format( pdb1, pdb2 )
return
[docs]def molecular_weight(pdbin):
logfile = "rwcontents.log"
_run_rwcontents(pdbin, logfile)
_, _, mw = _parse_rwcontents(logfile)
os.unlink(logfile)
return mw
[docs]def num_atoms_and_residues(pdbin,first=False):
""""Return number of atoms and residues in a pdb file.
If all is True, return all atoms and residues, else just for the first chain in the first model'
"""
#pdb_obj = iotbx.pdb.hierarchy.input(file_name=pdbin)
#model = pdb_obj.hierarchy.models()[0]
#return sum( [ len( chain.residues() ) for chain in model.chains() ] )
if not first:
logfile = "rwcontents.log"
_run_rwcontents(pdbin, logfile)
natoms, nresidues, _ = _parse_rwcontents(logfile)
os.unlink(logfile)
else:
pdb_obj = iotbx.pdb.hierarchy.input(file_name=pdbin)
model=pdb_obj.hierarchy.models()[0]
nresidues=len(model.chains()[0].residues())
natoms=len(model.chains()[0].atoms())
assert natoms > 0 and nresidues > 0
return (natoms, nresidues)
def _parse_rwcontents(logfile):
natoms = 0
nresidues = 0
molecular_weight = 0
with open( logfile ) as f:
for line in f:
if line.startswith(" Number of amino-acids residues"):
nresidues = int(line.strip().split()[5])
#Total number of protein atoms (including hydrogens)
if line.startswith(" Total number of atoms (including hydrogens)"):
natoms = int(float(line.strip().split()[6]))
if line.startswith(" Molecular Weight of protein:"):
molecular_weight = float(line.strip().split()[4])
return natoms, nresidues, molecular_weight
def _run_rwcontents(pdbin, logfile):
logfile = os.path.abspath(logfile)
cmd=[ 'rwcontents', 'xyzin', pdbin ]
stdin='' # blank to trigger EOF
retcode = ample_util.run_command(cmd=cmd,
directory=os.getcwd(),
logfile=logfile,
stdin=stdin)
if retcode != 0:
raise RuntimeError,"Error running cmd {0}\nSee logfile: {1}".format(cmd,logfile)
return
def _parse_modres(modres_text):
"""
COLUMNS DATA TYPE FIELD DEFINITION
--------------------------------------------------------------------------------
1 - 6 Record name "MODRES"
8 - 11 IDcode idCode ID code of this entry.
13 - 15 Residue name resName Residue name used in this entry.
17 Character chainID Chain identifier.
19 - 22 Integer seqNum Sequence number.
23 AChar iCode Insertion code.
25 - 27 Residue name stdRes Standard residue name.
30 - 70 String comment Description of the residue modification.
"""
modres = []
for line in modres_text:
assert line[0:6] == "MODRES","Line did not begin with an MODRES record!: {0}".format(line)
idCode = line[7:11]
resName = line[12:15].strip()
# Use for all so None means an empty field
if line[16].strip(): chainID = line[16]
seqNum = int(line[18:22])
iCode = ""
if line[22].strip(): iCode = line[22]
stdRes = line[24:27].strip()
comment = ""
if line[29:70].strip(): comment = line[29:70].strip()
modres.append([idCode, resName, chainID, seqNum, iCode, stdRes,comment])
return modres
[docs]def prepare_nmr_model(nmr_model_in,models_dir):
"""Split an nmr pdb into its constituent parts and standardise the lengths"""
if not os.path.isdir(models_dir): os.mkdir(models_dir)
split_pdbs = split_pdb(nmr_model_in, models_dir)
# We can only work with equally sized PDBS so we pick the most numerous if there are different sizes
lengths = {}
lmax = 0
for pdb in split_pdbs:
h = iotbx.pdb.pdb_input(pdb).construct_hierarchy()
l = h.models()[0].chains()[0].residue_groups_size()
if l not in lengths:
lengths[l] = [pdb]
else:
lengths[l].append(pdb)
lmax = max(lmax,l)
if len(lengths) > 1:
# The pdbs were of different lengths
to_keep = lengths[lmax]
_logger.info('All NMR models were not of the same length, only {0} will be kept.'.format(len(to_keep)))
# Delete any that are not of most numerous length
for p in [p for p in split_pdbs if p not in to_keep]: os.unlink(p)
split_pdbs = to_keep
return split_pdbs
[docs]def reliable_sidechains(inpath=None, outpath=None ):
"""Only output non-backbone atoms for residues in the res_names list.
"""
# Remove sidechains that are in res_names where the atom name is not in atom_names
res_names = [ 'MET', 'ASP', 'PRO', 'GLN', 'LYS', 'ARG', 'GLU', 'SER']
atom_names = [ 'N', 'CA', 'C', 'O', 'CB' ]
# print 'Found ',each_file
pdb_in = open( inpath, "r" )
pdb_out = open( outpath, "w" )
for pdbline in pdb_in:
pdb_pattern = re.compile('^ATOM\s*(\d*)\s*(\w*)\s*(\w*)\s*(\w)\s*(\d*)\s')
pdb_result = pdb_pattern.match(pdbline)
# Check ATOM line and for residues in res_name, skip any that are not in atom names
if pdb_result:
pdb_result2 = re.split(pdb_pattern, pdbline)
if pdb_result2[3] in res_names and not pdb_result2[2] in atom_names:
continue
# Write out everything else
pdb_out.write(pdbline)
#End for
pdb_out.close()
pdb_in.close()
return
[docs]def reliable_sidechains_cctbx(pdbin=None, pdbout=None ):
"""Only output non-backbone atoms for residues in the res_names list.
"""
# Remove sidechains that are in res_names where the atom name is not in atom_names
res_names = [ 'MET', 'ASP', 'PRO', 'GLN', 'LYS', 'ARG', 'GLU', 'SER']
atom_names = [ 'N', 'CA', 'C', 'O', 'CB' ]
pdb_input=iotbx.pdb.pdb_input(pdbin)
hierachy=pdb_input.construct_hierarchy()
# Remove HETATMS
for model in hierachy.models():
for chain in model.chains():
for residue_group in chain.residue_groups():
assert not residue_group.have_conformers(),"Fix for conformers"
if residue_group.unique_resnames()[0] not in res_names:
# removing whilst looping through?!? - maybe...
chain.remove_residue_group(residue_group)
continue
for atom_group in residue_group.atom_groups():
# Can't use below as it uses indexes which change as we remove atoms
# ag.atoms().extract_hetero()]
todel=[a for a in atom_group.atoms() if a.name.strip() in atom_names ]
for a in todel: atom_group.remove_atom(a)
# Need to get crystal info and include
hierachy.write_pdb_file(pdbout,anisou=False)
return
[docs]def rename_chains(inpdb=None, outpdb=None, fromChain=None, toChain=None ):
"""Rename Chains
"""
assert len(fromChain) == len(toChain)
logfile = outpdb+".log"
cmd="pdbcur xyzin {0} xyzout {1}".format( inpdb, outpdb ).split()
# Build up stdin
stdin = ""
for i in range( len( fromChain ) ):
stdin += "renchain {0} {1}\n".format( fromChain[ i ], toChain[ i ] )
retcode = ample_util.run_command(cmd=cmd, logfile=logfile, directory=os.getcwd(), dolog=False, stdin=stdin)
if retcode == 0:
# remove temporary files
os.unlink(logfile)
else:
raise RuntimeError,"Error renaming chains {0}".format( fromChain )
return
[docs]def resseq(pdbin):
return _resseq(iotbx.pdb.pdb_input(pdbin).construct_hierarchy())
def _resseq(hierarchy):
"""Extract the sequence of residues from a pdb file."""
chain2data = _sequence_data(hierarchy)
return dict((k,chain2data[k][1]) for k in chain2data.keys())
[docs]def renumber_residues(pdbin, pdbout, start=1):
""" Renumber the residues in the chain """
pdb_input = iotbx.pdb.pdb_input(file_name=pdbin)
hierarchy = pdb_input.construct_hierarchy()
_renumber(hierarchy, start)
with open(pdbout,'w') as f:
f.write("REMARK Original file:\n")
f.write("REMARK {0}\n".format(pdbin))
f.write(hierarchy.as_pdb_string(anisou=False))
return
def _renumber(hierarchy, start):
for model in hierarchy.models():
for chain in model.chains():
for idx, residue_group in enumerate(chain.residue_groups()):
residue_group.resseq = idx + start
return
[docs]def renumber_residues_gaps(pdbin, pdbout, gaps, start=1):
"""
Renumber the residues in the chain based on specified gaps
Parameters
----------
pdbin : str
pdbout : str
gaps : list
List containing True/False for gaps
"""
pdb_input = iotbx.pdb.pdb_input(file_name=pdbin)
hierarchy = pdb_input.construct_hierarchy()
for model in hierarchy.models():
for chain in model.chains():
resseq = 0
for idx, is_gap in enumerate(gaps):
if is_gap:
continue
residue_group = chain.residue_groups()[resseq]
residue_group.resseq = idx + start
resseq += 1
with open(pdbout, 'w') as f:
f.write("REMARK Original file:\n")
f.write("REMARK {0}\n".format(pdbin))
f.write(hierarchy.as_pdb_string(anisou=False))
return
[docs]def Xselect_residues(inpath=None, outpath=None, residues=None):
"""Create a new pdb by selecting only the numbered residues from the list.
This only keeps ATOM lines - everything else gets discarded.
Args:
infile: path to input pdb
outfile: path to output pdb
residues: list of integers of the residues to keep
Return:
Number of residues written
"""
assert inpath, outpath
assert type(residues) == list
# Loop through PDB files and create new ones that only contain the residues specified in the list
count=0
with open(inpath, "r") as pdb_in, open(outpath , "w") as pdb_out:
for line in pdb_in:
if line.startswith("ATOM"):
atom = pdb_model.PdbAtom( line )
if int( atom.resSeq ) in residues: #convert to ints to compare
count += 1
pdb_out.write(line)
return count
[docs]def select_residues(pdbin, pdbout, delete=None, tokeep=None, delete_idx=None, tokeep_idx=None):
pdbf = iotbx.file_reader.any_file(pdbin, force_type="pdb")
pdbf.check_file_type("pdb")
hierarchy = pdbf.file_object.construct_hierarchy()
crystal_symmetry=pdbf.file_object.crystal_symmetry()
if len(hierarchy.models()) > 1 or len(hierarchy.models()[0].chains()) > 1:
print "pdb {0} has > 1 model or chain - only first model/chain will be kept".format(pdbin)
if len(hierarchy.models()) > 1:
for i, m in enumerate(hierarchy.models()):
if i != 0: hierarchy.remove_model(m)
model = hierarchy.models()[0]
if len(model.chains()) > 1:
for i, c in enumerate(model.chains()):
if i != 0: model.remove_chain(c)
chain = model.chains()[0]
idx=-1
for residue_group in chain.residue_groups():
# We ignore hetatms when indexing as we are concerned with residue indexes
if delete_idx or tokeep_idx:
if any([atom.hetero for atom in residue_group.atoms()]): continue
idx += 1
remove=False
if delete:
if residue_group.resseq_as_int() in delete: remove = True
elif delete_idx:
if idx in delete: remove = True
elif tokeep:
if residue_group.resseq_as_int() not in tokeep: remove = True
elif tokeep_idx:
if idx not in tokeep_idx: remove = True
if remove:
chain.remove_residue_group(residue_group)
#hierarchy.write_pdb_file(pdbout,anisou=False)
with open(pdbout,'w') as f:
f.write("REMARK Original file:\n")
f.write("REMARK {0}\n".format(pdbin))
if (crystal_symmetry is not None) :
f.write(iotbx.pdb.format_cryst1_and_scale_records(crystal_symmetry=crystal_symmetry,
write_scale_records=True)+"\n")
f.write(hierarchy.as_pdb_string(anisou=False))
return
[docs]def sequence(pdbin):
return _sequence(iotbx.pdb.pdb_input(pdbin).construct_hierarchy())
def _sequence(hierarchy):
"""Extract the sequence of residues from a pdb file."""
chain2data = _sequence_data(hierarchy)
return dict((k,chain2data[k][0]) for k in chain2data.keys())
def _sequence1(hierarchy):
"""Return sequence of the first chain"""
d = _sequence(hierarchy)
return d[sorted(d.keys())[0]]
[docs]def sequence_data(pdbin):
return _sequence_data(iotbx.pdb.pdb_input(pdbin).construct_hierarchy())
def _sequence_data(hierarchy):
"""Extract the sequence of residues and resseqs from a pdb file."""
chain2data={}
for chain in set(hierarchy.models()[0].chains()): # only the first model
if not chain.is_protein(): continue
got=False
seq=""
resseq=[]
for residue in chain.conformers()[0].residues(): # Just look at the first conformer
# See if any of the atoms are non-hetero - if so we add this residue
if any([not atom.hetero for atom in residue.atoms()]):
got=True
seq += three2one[residue.resname]
#resseq.append(int(residue.resseq.strip()))
resseq.append(residue.resseq_as_int())
if got: chain2data[chain.id] = (seq,resseq)
return chain2data
[docs]def Xsplit(pdbin):
"""Split a pdb into separate models"""
name=os.path.splitext(os.path.basename(pdbin))[0]
pdb_input=iotbx.pdb.pdb_input(pdbin)
hierachy=pdb_input.construct_hierarchy()
# Test code for getting info
# print "GOT ",[ x for x in pdb_input.title_section()]
# print "GOT2 ",pdb_input.extract_header_year()
# print "GOT3 ",pdb_input.get_solvent_content()
# print "GOT3 ",pdb_input.get_matthews_coeff()
# from iotbx.pdb.mining import extract_best_resolution
# print "RES ",extract_best_resolution(pdb_input.remark_section())
# print "CODE ",extract_header_pdb_code(pdb_input)
# print "TITLE ",extract_header_title(pdb_input)
crystal_symmetry=pdb_input.crystal_symmetry()
for i,model in enumerate(hierachy.models()):
m=model.detached_copy()
h=iotbx.pdb.hierarchy.root()
h.append_model(m)
pdbout="{0}_{1}.pdb".format(name,i)
h.write_pdb_file(pdbout,crystal_symmetry=crystal_symmetry,anisou=False)
return
[docs]def split_pdb(pdbin, directory=None):
"""Split a pdb file into its separate models"""
if directory is None: directory = os.path.dirname(pdbin)
# Largely stolen from pdb_split_models.py in phenix
#http://cci.lbl.gov/cctbx_sources/iotbx/command_line/pdb_split_models.py
pdbf = iotbx.file_reader.any_file(pdbin, force_type="pdb")
pdbf.check_file_type("pdb")
hierarchy = pdbf.file_object.construct_hierarchy()
# Nothing to do
n_models = hierarchy.models_size()
if n_models == 1: raise RuntimeError,"split_pdb {0} only contained 1 model!".format( pdbin )
crystal_symmetry=pdbf.file_object.crystal_symmetry()
output_files = []
for k, model in enumerate(hierarchy.models()) :
k += 1
new_hierarchy = iotbx.pdb.hierarchy.root()
new_hierarchy.append_model(model.detached_copy())
if (model.id == "") :
model_id = str(k)
else:
model_id = model.id.strip()
output_file = ample_util.filename_append(pdbin, model_id, directory)
with open(output_file, "w") as f:
if (crystal_symmetry is not None) :
print >> f, iotbx.pdb.format_cryst1_and_scale_records(
crystal_symmetry=crystal_symmetry,
write_scale_records=True)
print >> f, "REMARK Model %d of %d" % (k, n_models)
if (pdbin is not None) :
print >> f, "REMARK Original file:"
print >> f, "REMARK %s" % pdbin
f.write(new_hierarchy.as_pdb_string())
output_files.append(output_file)
return output_files
[docs]def split_into_chains(pdbin, chain=None, directory=None):
"""Split a pdb file into its separate chains"""
if directory is None: directory = os.path.dirname(pdbin)
# Largely stolen from pdb_split_models.py in phenix
#http://cci.lbl.gov/cctbx_sources/iotbx/command_line/pdb_split_models.py
pdbf = iotbx.file_reader.any_file(pdbin, force_type="pdb")
pdbf.check_file_type("pdb")
hierarchy = pdbf.file_object.construct_hierarchy()
# Nothing to do
n_models = hierarchy.models_size()
if n_models != 1: raise RuntimeError,"split_into_chains only works with single-mdoel pdbs!"
crystal_symmetry = pdbf.file_object.crystal_symmetry()
output_files = []
n_chains = len(hierarchy.models()[0].chains())
for i, hchain in enumerate(hierarchy.models()[0].chains()):
if not hchain.is_protein(): continue
if chain and not hchain.id == chain: continue
new_hierarchy = iotbx.pdb.hierarchy.root()
new_model = iotbx.pdb.hierarchy.model()
new_hierarchy.append_model((new_model))
new_model.append_chain(hchain.detached_copy())
output_file = ample_util.filename_append(pdbin, hchain.id, directory)
with open(output_file, "w") as f:
if (crystal_symmetry is not None) :
print >> f, iotbx.pdb.format_cryst1_and_scale_records(
crystal_symmetry=crystal_symmetry,
write_scale_records=True)
print >> f, "REMARK Chain %d of %d" % (i, n_chains)
if (pdbin is not None) :
print >> f, "REMARK Original file:"
print >> f, "REMARK %s" % pdbin
f.write(new_hierarchy.as_pdb_string())
output_files.append(output_file)
if not len(output_files): raise RuntimeError,"split_into_chains could not find any chains to split"
return output_files
[docs]def standardise(pdbin, pdbout, chain=None, del_hetatm=False):
"""Rename any non-standard AA, remove solvent and only keep most probably conformation.
"""
tmp1 = ample_util.tmp_file_name() + ".pdb" # pdbcur insists names have a .pdb suffix
# Now clean up with pdbcur
logfile = tmp1+".log"
cmd="pdbcur xyzin {0} xyzout {1}".format(pdbin, tmp1).split()
stdin="""delsolvent
noanisou
mostprob
"""
# We are extracting one of the chains
if chain: stdin += "lvchain {0}\n".format( chain )
retcode = ample_util.run_command(cmd=cmd, logfile=logfile, directory=os.getcwd(), dolog=False, stdin=stdin)
if retcode == 0: os.unlink(logfile) # remove temporary files
else: raise RuntimeError,"Error standardising pdb!"
# Standardise AA names and then remove any remaining HETATMs
std_residues_cctbx(tmp1, pdbout, del_hetatm=del_hetatm)
os.unlink(tmp1)
return retcode
[docs]def Xstd_residues(pdbin, pdbout ):
"""Switch any non-standard AA's to their standard names.
We also remove any ANISOU lines.
"""
modres = [] # List of modres objects
modres_names = {} # list of names of the modified residues keyed by chainID
gotModel=False # to make sure we only take the first model
reading=False # If reading structure
pdbinf = open(pdbin,'r')
pdboutf = open(pdbout,'w')
line = True # Just for the first line
while line:
# Read in the line
line = pdbinf.readline()
# Skip any ANISOU lines
if line.startswith("ANISOU"):
continue
# Extract all MODRES DATA
if line.startswith("MODRES"):
modres.append( pdb_model.PdbModres( line ) )
# Only extract the first model
if line.startswith("MODEL"):
if gotModel:
raise RuntimeError,"Found additional model! {0}".format( line )
else:
gotModel=True
# First time we hit coordinates we set up our data structures
if not reading and ( line.startswith("HETATM") or line.startswith("ATOM") ):
# There is a clever way to do this with list comprehensions but this is not it...
for m in modres:
chainID = copy.copy( m.chainID )
if not modres_names.has_key( chainID ):
modres_names[ chainID ] = []
if m.resName not in modres_names[ chainID ]:
modres_names[ chainID ].append( m.resName )
# Now we're reading
reading=True
# Switch any residue names
if len( modres):
if line.startswith("HETATM"):
hetatm = pdb_model.PdbHetatm( line )
# See if this HETATM is in the chain we are reading and one of the residues to change
if hetatm.resName in modres_names[ hetatm.chainID ]:
for m in modres:
if hetatm.resName == m.resName and hetatm.chainID == m.chainID:
# Change this HETATM to an ATOM
atom = pdb_model.PdbAtom().fromHetatm( hetatm )
# Switch residue name
atom.resName = m.stdRes
# Convert to a line
line = atom.toLine()+"\n"
break
# Any HETATM have been dealt with so just process as usual
if line.startswith("ATOM"):
atom = pdb_model.PdbAtom( line )
if atom.resName not in three2one:
raise RuntimeError, "Unrecognised residue! {0}".format(line)
# Output everything else
pdboutf.write( line )
# END reading loop
return
[docs]def std_residues_cctbx(pdbin, pdbout, del_hetatm=False):
"""Map all residues in MODRES section to their standard counterparts
optionally delete all other HETATMS"""
pdb_input = iotbx.pdb.pdb_input(pdbin)
crystal_symmetry = pdb_input.crystal_symmetry()
# Get MODRES Section & build up dict mapping the changes
modres_text = [ l.strip() for l in pdb_input.primary_structure_section() \
if l.startswith("MODRES")]
modres={}
for id,resname,chain,resseq,icode,stdres,comment in _parse_modres(modres_text):
if not chain in modres:
modres[chain] = {}
modres[chain][int(resseq)] = (resname,stdres)
hierachy = pdb_input.construct_hierarchy()
for model in hierachy.models():
for chain in model.chains():
for residue_group in chain.residue_groups():
resseq = residue_group.resseq_as_int()
for atom_group in residue_group.atom_groups():
resname = atom_group.resname
if chain.id in modres and resseq in modres[chain.id] and modres[chain.id][resseq][0] == resname:
# Change modified name to std name
#assert modres[chain.id][resseq][0]==resname,\
#"Unmatched names: {0} : {1}".format(modres[chain.id][resseq][0],resname)
atom_group.resname = modres[chain.id][resseq][1]
# If any of the atoms are hetatms, set them to be atoms
for atom in atom_group.atoms():
if atom.hetero: atom.hetero=False
if del_hetatm: _strip(hierachy, hetatm=True)
with open(pdbout,'w') as f:
f.write("REMARK Original file:\n")
f.write("REMARK {0}\n".format(pdbin))
if (crystal_symmetry is not None) :
f.write(iotbx.pdb.format_cryst1_and_scale_records(crystal_symmetry=crystal_symmetry,
write_scale_records=True)+"\n")
f.write(hierachy.as_pdb_string(anisou=False))
return
[docs]def strip(pdbin, pdbout, hetatm=False, hydrogen=False, atom_types=[]):
assert hetatm or hydrogen or atom_types,"Need to set what to strip!"
pdb_input = iotbx.pdb.pdb_input(pdbin)
crystal_symmetry = pdb_input.crystal_symmetry()
hierachy = pdb_input.construct_hierarchy()
_strip(hierachy, hetatm=hetatm, hydrogen=hydrogen, atom_types=atom_types)
with open(pdbout,'w') as f:
f.write("REMARK Original file:\n")
f.write("REMARK {0}\n".format(pdbin))
if (crystal_symmetry is not None) :
f.write(iotbx.pdb.format_cryst1_and_scale_records(crystal_symmetry=crystal_symmetry,
write_scale_records=True)+"\n")
f.write(hierachy.as_pdb_string(anisou=False))
return
def _strip(hierachy, hetatm=False, hydrogen=False, atom_types=[]):
"""Remove all hetatoms from pdbfile"""
def remove_atom(atom, hetatm=False, hydrogen=False, atom_types=[]):
return (hetatm and atom.hetero) or (hydrogen and atom.element_is_hydrogen()) or atom.name.strip() in atom_types
for model in hierachy.models():
for chain in model.chains():
for residue_group in chain.residue_groups():
for atom_group in residue_group.atom_groups():
to_del = [ a for a in atom_group.atoms() if remove_atom(a, hetatm=hetatm, hydrogen=hydrogen, atom_types=atom_types)]
for atom in to_del:
atom_group.remove_atom(atom)
return
[docs]def to_single_chain(inpath, outpath):
"""Condense a single-model multi-chain pdb to a single-chain pdb"""
o = open( outpath, 'w' )
firstChainID = None
currentResSeq = None # current residue we are reading - assume it always starts from 1
globalResSeq = None
globalSerial = -1
for line in open(inpath):
# Remove any HETATOM lines and following ANISOU lines
if line.startswith("HETATM") or line.startswith("MODEL") or line.startswith("ANISOU"):
raise RuntimeError,"Cant cope with the line: {0}".format( line )
# Skip any TER lines
if line.startswith("TER"):
continue
if line.startswith("ATOM"):
changed=False
atom = pdb_model.PdbAtom( line )
# First atom/residue
if globalSerial == -1:
globalSerial = atom.serial
firstChainID = atom.chainID
globalResSeq = atom.resSeq
currentResSeq = atom.resSeq
else:
# Change residue numbering and chainID
if atom.chainID != firstChainID:
atom.chainID = firstChainID
changed=True
# Catch each change in residue
if atom.resSeq != currentResSeq:
# Change of residue
currentResSeq = atom.resSeq
globalResSeq += 1
# Only change if don't match global
if atom.resSeq != globalResSeq:
atom.resSeq = globalResSeq
changed=True
# Catch each change in numbering
if atom.serial != globalSerial + 1:
atom.serial = globalSerial + 1
changed=True
if changed:
line = atom.toLine()+"\n"
# Increment counter for all atoms
globalSerial += 1
o.write( line )
o.close()
return
[docs]def translate(inpdb=None, outpdb=None, ftranslate=None):
"""translate pdb
args:
ftranslate -- vector of fractional coordinates to shift by
"""
logfile = outpdb+".log"
cmd="pdbcur xyzin {0} xyzout {1}".format( inpdb, outpdb ).split()
# Build up stdin
stdin='translate * frac {0:F} {1:F} {2:F}'.format( ftranslate[0], ftranslate[1], ftranslate[2] )
retcode = ample_util.run_command(cmd=cmd, logfile=logfile, directory=os.getcwd(), dolog=False, stdin=stdin)
if retcode == 0:
# remove temporary files
os.unlink(logfile)
else:
raise RuntimeError,"Error translating PDB"
return
[docs]def xyz_coordinates(pdbin):
''' Extract xyz for all atoms '''
pdb_input = iotbx.pdb.pdb_input(file_name=pdbin)
hierarchy = pdb_input.construct_hierarchy()
return _xyz_coordinates(hierarchy)
def _xyz_coordinates(hierarchy):
res_lst,tmp = [],[]
for residue_group in hierarchy.models()[0].chains()[0].residue_groups():
for atom_group in residue_group.atom_groups():
for atom in atom_group.atoms():
tmp.append( atom.xyz )
res_lst.append([residue_group.resseq_as_int(), tmp])
tmp=[]
return res_lst
[docs]def xyz_cb_coordinates(pdbin):
''' Extract xyz for CA/CB atoms '''
pdb_input = iotbx.pdb.pdb_input(file_name=pdbin)
hierarchy = pdb_input.construct_hierarchy()
res_dict = _xyz_cb_coordinates(hierarchy)
cb_lst = []
for i in xrange(len(res_dict)):
if len(res_dict[i]) > 1:
cb_lst.append(res_dict[i][1])
elif len(res_dict[i]) == 1:
cb_lst.append(res_dict[i][0])
return cb_lst
def _xyz_cb_coordinates(hierarchy):
res_lst = []
for residue_group in hierarchy.models()[0].chains()[0].residue_groups():
for atom_group in residue_group.atom_groups():
xyz_lst = _xyz_atom_coords(atom_group)
res_lst.append([residue_group.resseq_as_int(), xyz_lst])
return res_lst
def _xyz_atom_coords(atom_group):
''' Use this method if you need to identify if CB is present
in atom_group and if not return CA
'''
tmp_dict = {}
for atom in atom_group.atoms():
if atom.name.strip() in set(["CA", "CB"]):
tmp_dict[atom.name.strip()] = atom.xyz
if 'CB' in tmp_dict: return tmp_dict['CB']
elif 'CA' in tmp_dict: return tmp_dict['CA']
else: return (float('inf'), float('inf'), float('inf'))
[docs]class Test(unittest.TestCase):
[docs] @classmethod
def setUpClass(cls):
"""
Set up paths. Need to do this with setUpClass, as otherwise the __file__
variable is updated whenever the cwd is changed in a test and the next test
gets the wrong paths.
"""
cls.thisd = os.path.abspath( os.path.dirname( __file__ ) )
paths = cls.thisd.split( os.sep )
cls.ample_dir = os.sep.join( paths[ : -1 ] )
cls.tests_dir=os.path.join(cls.ample_dir,"tests")
cls.testfiles_dir = os.path.join(cls.tests_dir,'testfiles')
return
[docs] def testGetInfo1(self):
""""""
pdbfile = os.path.join(self.testfiles_dir,"1GU8.pdb")
info = get_info( pdbfile )
self.assertEqual( info.pdbCode, "1GU8" )
self.assertEqual( len(info.models), 2 )
m1 = info.models[0]
self.assertEqual( m1.chains[0], 'A' )
self.assertEqual( m1.resSeqs[0], [2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 154, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164, 165, 166, 167, 168, 169, 170, 171, 172, 173, 174, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208, 209, 210, 211, 212, 213, 214, 215, 216, 217, 218, 219] )
self.assertEqual( m1.sequences[0], 'VGLTTLFWLGAIGMLVGTLAFAWAGRDAGSGERRYYVTLVGISGIAAVAYVVMALGVGWVPVAERTVFAPRYIDWILTTPLIVYFLGLLAGLDSREFGIVITLNTVVMLAGFAGAMVPGIERYALFGMGAVAFLGLVYYLVGPMTESASQRSSGIKSLYVRLRNLTVILWAIYPFIWLLGPPGVALLTPTVDVALIVYLDLVTKVGFGFIALDAAATL' )
self.assertEqual( m1.caMask[0], [ False ] * 218 )
self.assertEqual( m1.bbMask[0], [False, True, False, False, False, False, False, False, False, True, False, False, True, False, False, False, True, False, False, False, False, False, False, False, True, False, False, False, True, False, True, False, False, False, False, False, False, False, False, False, True, False, False, True, False, False, False, False, False, False, False, False, False, False, False, True, False, True, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, True, False, False, False, True, False, False, False, False, False, False, True, False, False, False, False, False, False, False, False, False, False, False, False, True, False, False, True, False, False, False, False, True, False, False, False, False, False, False, False, True, False, True, False, False, False, False, False, True, False, False, False, False, False, False, True, False, False, False, False, False, False, False, False, False, False, False, True, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, True, False, False, True, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, True, False, True, False, False, False, False, False, False, False, False, False, True] )
self.assertEqual( info.numAtoms( modelIdx=0 ), 1621 )
self.assertEqual( info.numCalpha( modelIdx=0 ), 218 )
m2 = info.models[1]
self.assertEqual( m2.chains[0], 'A' )
self.assertEqual( m2.resSeqs[0], [2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 154, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164, 165, 166, 167, 168, 169, 170, 171, 172, 173, 174, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208, 209, 210, 211, 212, 213, 214, 215, 216, 217, 218, 219] )
self.assertEqual( m2.sequences[0], 'VGLTTLFWLGAIGMLVGTLAFAWAGRDAGSGERRYYVTLVGISGIAAVAYVVMALGVGWVPVAERTVFAPRYIDWILTTPLIVYFLGLLAGLDSREFGIVITLNTVVMLAGFAGAMVPGIERYALFGMGAVAFLGLVYYLVGPMTESASQRSSGIKSLYVRLRNLTVILWAIYPFIWLLGPPGVALLTPTVDVALIVYLDLVTKVGFGFIALDAAATL' )
self.assertEqual( info.numAtoms( modelIdx=1 ), 1621 )
self.assertEqual( info.numCalpha( modelIdx=1 ), 218 )
return
[docs] def testGetInfo2(self):
""""""
pdbfile = os.path.join(self.testfiles_dir,"2UUI.pdb")
info = get_info( pdbfile )
self.assertEqual( len(info.models), 1 )
m1 = info.models[0]
self.assertEqual( m1.chains[0], 'A' )
self.assertEqual( m1.resSeqs[0], [ i for i in range(-5,150) ] )
self.assertEqual( m1.sequences[0], 'MHHHHHHKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPW' )
self.assertEqual( m1.caMask[0], [ False ] * 154 + [ True ] )
self.assertEqual( m1.bbMask[0], [False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, True, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, True, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, True, False, False, False, False, False, True, False, False, False, False, False, True, False, False, False, False, False, False, False, False, False, False, False, False, True, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, True, False, False, False, False, False, False, False, False, False, False, False, False, False, False, False, True, False, False, False, False, True, True, True, True] )
self.assertEqual( info.numAtoms( modelIdx=0 ), 1263 )
return
[docs] def testCheckPdbs(self):
logging.basicConfig()
logging.getLogger().setLevel(logging.DEBUG)
pdbs=glob.glob(os.path.join(self.testfiles_dir,"models","*.pdb"))
self.assertTrue(check_pdbs(pdbs))
self.assertFalse(check_pdbs(pdbs, single=True,sequence="AABBCC"))
pdbs += [ os.path.join(self.testfiles_dir,"1GU8.pdb") ]
self.assertFalse(check_pdbs(pdbs,single=True,sequence="AABBCC"))
return
[docs] def testSelectResidues(self):
pdbin = os.path.join(self.testfiles_dir,"4DZN.pdb")
pdbout = "testSelectResidues1.pdb"
to_delete = [5,10,15,20]
b4 = set(resseq(pdbin)['A'])
select_residues(pdbin=pdbin, pdbout=pdbout, delete=to_delete)
after = set(resseq(pdbout)['A'])
self.assertEqual(after,b4.difference(set(to_delete)))
os.unlink(pdbout)
return
[docs] def testSelectResiduesKeepIdxs(self):
pdbin = os.path.join(self.testfiles_dir,"4DZN.pdb")
pdbout = "testSelectResidues2.pdb"
tokeep_idx = [0,5,10,15,20]
b4 = [ r for i,r in enumerate(resseq(pdbin)['A']) if i in tokeep_idx ]
select_residues(pdbin=pdbin, pdbout=pdbout, tokeep_idx=tokeep_idx)
#hierachy=iotbx.pdb.pdb_input(pdbout).construct_hierarchy()
#print [a.name for a in hierachy.models()[0].chains()[0].atoms() ]
#print "GOT ",resseq(pdbout)
after = resseq(pdbout)['A']
self.assertEqual(after,b4)
os.unlink(pdbout)
return
[docs] def testSequence1(self):
pdbin=os.path.join(self.testfiles_dir,"4DZN.pdb")
ref={ 'A' :'GEIAALKQEIAALKKEIAALKEIAALKQGYY',
'B' : 'GEIAALKQEIAALKKEIAALKEIAALKQGYY',
'C' : 'GEIAALKQEIAALKKEIAALKEIAALKQGYY' }
s=sequence(pdbin)
self.assertEqual(ref, s, "Bad _sequecne: {0}".format(s))
return
[docs] def XtestSplit(self):
pdbin=os.path.join(self.testfiles_dir,"1GU8.pdb")
Xsplit(pdbin)
#os.unlink(pdbout)
return
[docs] def testStdResidues(self):
pdbin=os.path.join(self.testfiles_dir,"4DZN.pdb")
pdbout="std.pdb"
std_residues_cctbx(pdbin, pdbout)
# Check it's valid
pdb_obj = iotbx.pdb.hierarchy.input(file_name=pdbout)
#Get list of all the residue names in chain 1
resnames=[g.unique_resnames()[0] for g in pdb_obj.hierarchy.models()[0].chains()[0].residue_groups()]
ref=['ACE', 'GLY', 'GLU', 'ILE', 'ALA', 'ALA', 'LEU', 'LYS', 'GLN', 'GLU', 'ILE', 'ALA', 'ALA', 'LEU',
'LYS', 'LYS', 'GLU', 'ILE', 'ALA', 'ALA', 'LEU', 'LYS', 'PHE', 'GLU', 'ILE', 'ALA', 'ALA', 'LEU',
'LYS', 'GLN', 'GLY', 'TYR', 'TYR']
self.assertEqual(resnames,ref)
os.unlink(pdbout)
return
[docs] def testStdResiduesCctbx(self):
pdbin=os.path.join(self.testfiles_dir,"4DZN.pdb")
pdbout="std.pdb"
std_residues_cctbx(pdbin, pdbout)
# Check it's valid
pdb_obj = iotbx.pdb.hierarchy.input(file_name=pdbout)
#Get list of all the residue names in chain 1
resnames=[g.unique_resnames()[0] for g in pdb_obj.hierarchy.models()[0].chains()[0].residue_groups()]
ref=['ACE', 'GLY', 'GLU', 'ILE', 'ALA', 'ALA', 'LEU', 'LYS', 'GLN', 'GLU', 'ILE', 'ALA', 'ALA', 'LEU',
'LYS', 'LYS', 'GLU', 'ILE', 'ALA', 'ALA', 'LEU', 'LYS', 'PHE', 'GLU', 'ILE', 'ALA', 'ALA', 'LEU',
'LYS', 'GLN', 'GLY', 'TYR', 'TYR']
self.assertEqual(resnames,ref)
os.unlink(pdbout)
return
[docs] def testStripHetatm(self):
pdbin = os.path.join(self.testfiles_dir,"1BYZ.pdb")
pdbout='strip_het.pdb'
hierachy = iotbx.pdb.pdb_input(pdbin).construct_hierarchy()
_strip(hierachy, hetatm=True, hydrogen=False)
hierachy.write_pdb_file(pdbout,anisou=False)
with open(pdbout) as f:
got = any([ True for l in f.readlines() if l.startswith('HETATM') ])
self.assertFalse(got, "Found HETATMS")
os.unlink(pdbout)
return
[docs] def testStripHydrogen(self):
pdbin = os.path.join(self.testfiles_dir,"1BYZ.pdb")
pdbout='strip_H.pdb'
hierachy = iotbx.pdb.pdb_input(pdbin).construct_hierarchy()
_strip(hierachy, hetatm=False, hydrogen=True)
hierachy.write_pdb_file(pdbout,anisou=False)
with open(pdbout) as f:
got = any([ True for l in f.readlines() if l.startswith('ATOM') and l[13] == 'H' ])
self.assertFalse(got, "Found Hydrogens")
os.unlink(pdbout)
return
[docs] def testStripAtomTypes(self):
pdbin = os.path.join(self.testfiles_dir,"1BYZ.pdb")
pdbout='strip_types.pdb'
hierachy = iotbx.pdb.pdb_input(pdbin).construct_hierarchy()
_strip(hierachy, hetatm=False, hydrogen=False, atom_types=['CB'])
hierachy.write_pdb_file(pdbout,anisou=False)
with open(pdbout) as f:
got = any([ True for l in f.readlines() if l.startswith('ATOM') and l[12:15].strip() == 'CB' ])
self.assertFalse(got, "Found Atom Types")
os.unlink(pdbout)
return
[docs] def testReliableSidechains(self):
pdbin=os.path.join(self.testfiles_dir,"1GU8.pdb")
pdbout="std.pdb"
reliable_sidechains(pdbin, pdbout)
# Check it's valid
pdb_obj = iotbx.pdb.hierarchy.input(file_name=pdbout)
#Get list of all the residue names in chain 1
resnames=[g.unique_resnames()[0] for g in pdb_obj.hierarchy.models()[0].chains()[0].residue_groups()]
ref=['VAL', 'GLY', 'LEU', 'THR', 'THR', 'LEU', 'PHE', 'TRP', 'LEU', 'GLY', 'ALA', 'ILE', 'GLY', 'MET',
'LEU', 'VAL', 'GLY', 'THR', 'LEU', 'ALA', 'PHE', 'ALA', 'TRP', 'ALA', 'GLY', 'ARG', 'ASP', 'ALA',
'GLY', 'SER', 'GLY', 'GLU', 'ARG', 'ARG', 'TYR', 'TYR', 'VAL', 'THR', 'LEU', 'VAL', 'GLY', 'ILE',
'SER', 'GLY', 'ILE', 'ALA', 'ALA', 'VAL', 'ALA', 'TYR', 'VAL', 'VAL', 'MET', 'ALA', 'LEU', 'GLY',
'VAL', 'GLY', 'TRP', 'VAL', 'PRO', 'VAL', 'ALA', 'GLU', 'ARG', 'THR', 'VAL', 'PHE', 'ALA', 'PRO',
'ARG', 'TYR', 'ILE', 'ASP', 'TRP', 'ILE', 'LEU', 'THR', 'THR', 'PRO', 'LEU', 'ILE', 'VAL', 'TYR',
'PHE', 'LEU', 'GLY', 'LEU', 'LEU', 'ALA', 'GLY', 'LEU', 'ASP', 'SER', 'ARG', 'GLU', 'PHE', 'GLY',
'ILE', 'VAL', 'ILE', 'THR', 'LEU', 'ASN', 'THR', 'VAL', 'VAL', 'MET', 'LEU', 'ALA', 'GLY', 'PHE',
'ALA', 'GLY', 'ALA', 'MET', 'VAL', 'PRO', 'GLY', 'ILE', 'GLU', 'ARG', 'TYR', 'ALA', 'LEU', 'PHE',
'GLY', 'MET', 'GLY', 'ALA', 'VAL', 'ALA', 'PHE', 'LEU', 'GLY', 'LEU', 'VAL', 'TYR', 'TYR', 'LEU',
'VAL', 'GLY', 'PRO', 'MET', 'THR', 'GLU', 'SER', 'ALA', 'SER', 'GLN', 'ARG', 'SER', 'SER', 'GLY',
'ILE', 'LYS', 'SER', 'LEU', 'TYR', 'VAL', 'ARG', 'LEU', 'ARG', 'ASN', 'LEU', 'THR', 'VAL', 'ILE',
'LEU', 'TRP', 'ALA', 'ILE', 'TYR', 'PRO', 'PHE', 'ILE', 'TRP', 'LEU', 'LEU', 'GLY', 'PRO', 'PRO',
'GLY', 'VAL', 'ALA', 'LEU', 'LEU', 'THR', 'PRO', 'THR', 'VAL', 'ASP', 'VAL', 'ALA', 'LEU', 'ILE',
'VAL', 'TYR', 'LEU', 'ASP', 'LEU', 'VAL', 'THR', 'LYS', 'VAL', 'GLY', 'PHE', 'GLY', 'PHE', 'ILE',
'ALA', 'LEU', 'ASP', 'ALA', 'ALA', 'ALA', 'THR', 'LEU']
self.assertEqual(resnames,ref)
reliable_sidechains_cctbx(pdbin, pdbout)
pdb_obj = iotbx.pdb.hierarchy.input(file_name=pdbout)
self.assertEqual(resnames,ref)
os.unlink(pdbout)
return
[docs] def testXyzCoordinates(self):
pdbin=os.path.join(self.testfiles_dir,"4DZN.pdb")
test_hierarchy = iotbx.pdb.pdb_input( file_name=pdbin ).construct_hierarchy()
xyz_lst = _xyz_coordinates( test_hierarchy )
ref_data_start = [(0, [( 25.199, 11.913, -9.25),
( 25.201, 10.666, -9.372),
( 26.454, 12.702, -9.001)]),
(1, [( 24.076, 12.643, -9.179),
( 22.806, 12.124, -9.698),
( 22.170, 11.067, -8.799),
( 22.404, 11.024, -7.580)]),
(2, [( 21.377, 10.190, -9.397),
( 20.675, 9.156, -8.637),
( 21.614, 8.106, -7.996),
( 21.337, 7.619, -6.898),
( 19.625, 8.485, -9.531),
( 18.637, 7.595, -8.790),
( 17.652, 8.361, -7.951),
( 17.724, 9.603, -7.887),
( 16.786, 7.706, -7.365)])]
for idx in xrange(len( ref_data_start )): # Stuff that needs to be true
self.assertEqual( ref_data_start[idx][0], xyz_lst[idx][0] )
self.assertSequenceEqual(ref_data_start[idx][1], xyz_lst[idx][1] )
nr_atoms = sum(len(i[1]) for i in xyz_lst)
self.assertEqual(252, nr_atoms)
self.assertEqual(35, len(xyz_lst))
[docs] def testXyzCbCoordinates(self):
pdbin=os.path.join(self.testfiles_dir,"4DZN.pdb")
test_hierarchy = iotbx.pdb.pdb_input(file_name=pdbin).construct_hierarchy()
xyz_cb_lst = _xyz_cb_coordinates(test_hierarchy)
ref_data_start = [(0,(float('inf'), float('inf'), float('inf'))),
(1,(22.806, 12.124, -9.698)),
(2,(19.625, 8.485, -9.531)),
(3,(24.783, 6.398, -9.051)),
(4,(25.599, 10.846, -6.036)),
(5,(20.430, 10.143, -4.644))]
self.assertSequenceEqual(ref_data_start[1], xyz_cb_lst[1][:6])
self.assertEqual(35, len(xyz_cb_lst))
if __name__ == "__main__":
#unittest.TextTestRunner(verbosity=2).run(testSuite())
#
# Command-line handling
#
#unittest.TextTestRunner(verbosity=2).run(testSuite())
import argparse
parser = argparse.ArgumentParser(description='Manipulate PDB files', prefix_chars="-")
group = parser.add_mutually_exclusive_group()
group.add_argument('-ren', action='store_true',
help="Renumber the PDB")
group.add_argument('-std', action='store_true',
help='Standardise the PDB')
group.add_argument('-seq', action='store_true',
help='Write a fasta of the found AA to stdout')
group.add_argument('-split_models', action='store_true',
help='Split a pdb into constituent models')
group.add_argument('-split_chains', action='store_true',
help='Split a pdb into constituent chains')
parser.add_argument('input_file', #nargs='?',
help='The input file - will not be altered')
parser.add_argument('-o', dest='output_file',
help='The output file - will be created')
parser.add_argument('-chain', help='The chain to use')
parser.add_argument('-test', action='store_true',
help='Run unittests')
args = parser.parse_args()
if args.test:
print unittest.TestLoader().loadTestsFromModule(sys.modules[__name__])
sys.exit(unittest.TextTestRunner().run(unittest.TestLoader().loadTestsFromModule(sys.modules[__name__])))
# Get full paths to all files
args.input_file = os.path.abspath(args.input_file)
if not os.path.isfile(args.input_file):
raise RuntimeError, "Cannot find input file: {0}".format(args.input_file)
if args.output_file:
args.output_file = os.path.abspath(args.output_file)
else:
n = os.path.splitext( os.path.basename(args.input_file))[0]
args.output_file = n+"_std.pdb"
if args.ren:
renumber_residues(args.input_file, args.output_file, start=1)
elif args.std:
standardise(args.input_file, args.output_file, del_hetatm=True, chain=args.chain)
elif args.seq:
print sequence_util.Sequence(pdb=args.input_file).fasta_str()
elif args.split_models:
print split_pdb(args.input_file)
elif args.split_chains:
print split_into_chains(args.input_file, chain=args.chain)